KEGG   Homo sapiens (human): 29958Help
Entry
29958             CDS       T01001                                 

Gene name
DMGDH, DMGDHD, ME2GLYDH
Definition
dimethylglycine dehydrogenase (EC:1.5.8.4)
Orthology
K00315  
dimethylglycine dehydrogenase [EC:1.5.8.4]
Organism
hsa  Homo sapiens (human)
Pathway
Glycine, serine and threonine metabolism
Metabolic pathways
Disease
H01003  
Dimethylglycine dehydrogenase deficiency (DMGDHD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    29958 (DMGDH)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.8  With a flavin or flavoprotein as acceptor
    1.5.8.4  dimethylglycine dehydrogenase
     29958 (DMGDH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q14.1
AA seq 866 aa AA seqDB search
MLRPGAQLLRGLLLRSCPLQGSPGRPRSVCGREGEEKPPLSAETQWKDRAETVIIGGGCV
GVSLAYHLAKAGMKDVVLLEKSELTAGSTWHAAGLTTYFHPGINLKKIHYDSIKLYEKLE
EETGQVVGFHQPGSIRLATTPVRVDEFKYQMTRTGWHATEQYLIEPEKIQEMFPLLNMNK
VLAGLYNPGDGHIDPYSLTMALAAGARKCGALLKYPAPVTSLKARSDGTWDVETPQGSMR
ANRIVNAAGFWAREVGKMIGLEHPLIPVQHQYVVTSTISEVKALKRELPVLRDLEGSYYL
RQERDGLLFGPYESQEKMKVQDSWVTNGVPPGFGKELFESDLDRIMEHIKAAMEMVPVLK
KADIINVVNGPITYSPDILPMVGPHQGVRNYWVAIGFGYGIIHAGGVGKYLSDWILHGEP
PFDLIELDPNRYGKWTTTQYTEAKARESYGFNNIVGYPKEERFAGRPTQRVSGLYQRLES
KCSMGFHAGWEQPHWFYKPGQDTQYRPSFRRTNWFEPVGSEYKQVMQRVAVTDLSPFGKF
NIKGQDSIRLLDHLFANVIPKVGFTNISHMLTPKGRVYAELTVSHQSPGEFLLITGSGSE
LHDLRWIEEEAVKGGYDVEIKNITDELGVLGVAGPQARKVLQKLTSEDLSDDVFKFLQTK
SLKVSNIPVTAIRISYTGELGWELYHRREDSVALYDAIMNAGQEEGIDNFGTYAMNALRL
EKAFRAWGLEMNCDTNPLEAGLEYFVKLNKPADFIGKQALKQIKAKGLKRRLVCLTLATD
DVDPEGNESIWYNGKVVGNTTSGSYSYSIQKSLAFAYVPVQLSEVGQQVEVELLGKNYPA
VIIQEPLVLTEPTRNRLQKKGGKDKT
NT seq 2601 nt NT seq  +upstreamnt  +downstreamnt
atgctccgtcccggcgcgcagctgctgcggggcctcctgctgcggagctgcccgctgcag
ggctcccccgggcgcccgcgctctgtctgcggccgggaaggagaggaaaaaccaccctta
tctgcagaaacacaatggaaagacagagcagaaacagtgataattggaggtggctgtgtt
ggtgtgagtctggcttatcacctggccaaagcagggatgaaagatgtggtcctgctggag
aaatcagagctcacggctggatctacctggcacgcagcaggtttaacaacttactttcat
cctggaataaacttgaagaaaatacattatgatagcatcaaactttatgagaaactggaa
gaagaaactggtcaggtggtgggattccatcagccaggtagtatcagacttgctaccacc
cctgtaagggtagatgaatttaaatatcaaatgactcggactggctggcatgcaacagaa
cagtatctcattgaacctgaaaaaattcaagagatgttccctttactcaacatgaataag
gttttagctggattgtataatcctggagatggtcacattgatccttattctctaactatg
gcactggctgctggggctaggaaatgtggtgcccttttaaaatatcctgcaccagtaact
tctctgaaagccaggtcagatggaacatgggacgttgaaacaccacaggggtctatgaga
gcaaatagaattgtgaatgctgcaggattttgggctcgtgaagtaggtaaaatgattgga
ctagaacatcctctcattccggttcaacatcaatatgttgttacatcgactatatctgaa
gtgaaagctttgaaacgagaactgcctgtgctccgtgacctggaaggatcatattatctc
cgacaggaaagggatgggcttttgtttggtccatatgaaagtcaagagaaaatgaaagtt
caggactcctgggtcaccaatggagttcctccaggttttggaaaggaactctttgagtct
gatctagatcgaatcatggaacacatcaaagctgccatggaaatggttcctgtcttgaaa
aaggctgacatcatcaatgttgtcaatggtcctatcacgtattctcctgacattctgcct
atggtggggccccatcagggggtcagaaactactgggtggctataggctttggatatggc
ataatccacgctggtggggtagggaaatatctcagtgactggatcctgcatggagaacct
ccttttgatctgatagaattggatcctaatcgctatggcaaatggacaacaacccagtac
actgaggccaaagcaagagaatcatatggattcaacaatattgttggttatcctaaagaa
gaacggtttgctgggaggccgactcaacgagtcagtgggctctatcaaaggctggagtct
aagtgttccatggggttccatgctggctgggagcagccgcactggttctacaaaccaggc
caggacactcagtacaggccaagttttcgccgcacaaactggtttgagcctgtgggctcg
gagtataaacaggttatgcaaagagtagcggtaactgacctatcaccatttggcaagttt
aacatcaaaggccaagattccattagactactggaccatctctttgcaaatgtcattcca
aaggtgggttttacaaatataagtcacatgttaacacccaagggtcgagtgtatgctgag
ctgactgtttctcaccaatctcctggggagtttcttttaattactggctctggatcagaa
cttcatgatcttagatggattgaagaagaagcagtcaaaggtggatatgatgttgaaatt
aaaaacataactgatgagcttggagttcttggagttgctgggccacaggcaagaaaggtc
cttcagaaactgacctctgaagatcttagtgatgatgttttcaagtttcttcaaaccaag
tccttaaaggtttccaacattcctgtcactgctattaggatatcttatactggtgagctg
ggttgggagctgtatcacagaagagaagattctgtggcgctgtatgacgctatcatgaat
gcaggccaggaggagggaatcgacaattttggaacctatgccatgaatgccttacgcctg
gagaaagccttcagagcctgggggttagagatgaactgtgatacaaatcctttggaagct
ggactggaatattttgtgaagttaaataagccagcagacttcataggaaagcaagcactg
aaacagattaaagccaaggggctgaaacgaagactggtctgcctcaccttggcaacggat
gatgttgatccagagggaaatgaaagcatctggtacaatggcaaggtggttggcaacacg
acatctggaagctatagctacagcatccagaagagtctggctttcgcatatgtccctgta
caactaagtgaagtgggacagcaagtggaagttgaactattaggcaaaaattacccagca
gtcatcatacaagaacctttggtattgaccgaaccaaccagaaaccggcttcagaaaaaa
ggtggaaaggacaaaacttga

DBGET integrated database retrieval system