KEGG   Homo sapiens (human): 29974Help
Entry
29974             CDS       T01001                                 

Gene name
A1CF, ACF, ACF64, ACF65, APOBEC1CF, ASP
Definition
(RefSeq) APOBEC1 complementation factor
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 DND1_DSRM RRM_7 RRM_5 Limkain-b1 BRAP2 ERp29
Motif
Other DBs
NCBI-GeneID: 29974
NCBI-ProteinID: NP_001185749
HGNC: 24086
Ensembl: ENSG00000148584
Vega: OTTHUMG00000018240
Pharos: Q9NQ94(Tbio)
UniProt: Q9NQ94 A0A024QZI9 B4E1E3
Structure
PDB: 

Jmol
Position
10q11.23
AA seq 594 aa AA seqDB search
MEAVCLGTCPEPEASMSTAIPGLKKGNNALQSIILQTLLEKENGQRKYGGPPPGWDAAPP
ERGCEIFIGKLPRDLFEDELIPLCEKIGKIYEMRMMMDFNGNNRGYAFVTFSNKVEAKNA
IKQLNNYEIRNGRLLGVCASVDNCRLFVGGIPKTKKREEILSEMKKVTEGVVDVIVYPSA
ADKTKNRGFAFVEYESHRAAAMARRKLLPGRIQLWGHGIAVDWAEPEVEVDEDTMSSVKI
LYVRNLMLSTSEEMIEKEFNNIKPGAVERVKKIRDYAFVHFSNREDAVEAMKALNGKVLD
GSPIEVTLAKPVDKDSYVRYTRGTGGRGTMLQGEYTYSLGQVYDPTTTYLGAPVFYAPQT
YAAIPSLHFPATKGHLSNRAIIRAPSVRGAAGVRGLGGRGYLAYTGLGRGYQVKGDKRED
KLYDILPGMELTPMNPVTLKPQGIKLAPQILEEICQKNNWGQPVYQLHSAIGQDQRQLFL
YKITIPALASQNPAIHPFTPPKLSAFVDEAKTYAAEYTLQTLGIPTDGGDGTMATAAAAA
TAFPGYAVPNATAPVSAAQLKQAVTLGQDLAAYTTYEVYPTFAVTARGDGYGTF
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggaagcagtgtgtctgggcacatgcccagagccagaagcgagcatgagcacagcaatt
cctggcctcaaaaaaggaaataatgctttgcagtccatcattttgcaaactttgctggaa
aaggaaaatggacaaagaaaatatggtggccctccacctggttgggatgctgcaccccct
gaaaggggctgtgaaatttttattggaaaacttccccgagacctttttgaggatgagctt
ataccattatgtgaaaaaatcggtaaaatttatgaaatgagaatgatgatggattttaat
ggcaacaatagaggatatgcatttgtaacattttcaaataaagtggaagccaagaatgca
atcaagcaacttaataattatgaaattagaaatgggcgcctcttaggggtttgtgccagt
gtggacaactgccgattatttgttgggggcatcccaaaaaccaaaaagagagaagaaatc
ttatcggagatgaaaaaggttactgaaggtgttgtcgatgtcatcgtctacccaagcgct
gcagataaaaccaaaaaccgaggctttgccttcgtggagtatgagagtcatcgagcagct
gccatggcgaggaggaaactgctaccaggaagaattcagttatggggacatggtattgca
gtagactgggcagagccagaagtagaagttgatgaagatacaatgtcttcagtgaaaatc
ctatatgtaagaaatcttatgctgtctacctctgaagagatgattgaaaaggaattcaac
aatatcaaaccaggtgctgtggagagggtgaagaaaattcgagactatgcttttgtgcac
ttcagtaaccgagaagatgcagttgaggctatgaaagctttaaatggcaaggtgctggat
ggttcccccattgaagtcaccctagcaaaaccagtggacaaggacagttatgttaggtat
acccgaggcacaggtggaaggggcaccatgctgcaaggagagtatacctactctttgggc
caagtttatgatcccaccacaacctaccttggagctcctgtcttctatgccccccagacc
tatgcagcaattcccagtcttcatttcccagccaccaaaggacatctcagcaacagagcc
attatccgagccccttctgttagaggggctgcgggagtgagaggactgggcggccgtggc
tatttggcatacacaggcctgggtcgaggataccaggtcaaaggagacaaaagagaagac
aaactctatgacattttacctgggatggagctcaccccaatgaatcctgtcacattaaaa
ccccaaggaattaaactcgctccccagatattagaagagatttgtcagaaaaataactgg
ggacagccagtgtaccagctgcactctgctattggacaagaccaaagacagctattcttg
tacaaaataactattcctgctctagccagccagaatcctgcaatccaccctttcacacct
ccaaagctgagtgcctttgtggatgaagcaaagacgtatgcagccgaatacaccctgcag
accctgggcatccccactgatggaggcgatggcaccatggctactgctgctgctgctgct
actgctttcccaggatatgctgtccctaatgcaactgcacccgtgtctgcagcccagctc
aagcaagcggtaacccttggacaagacttagcagcatatacaacctatgaggtctaccca
acttttgcagtgactgcccgaggggatggatatggcaccttctga

DBGET integrated database retrieval system