KEGG   Homo sapiens (human): 29978Help
Entry
29978             CDS       T01001                                 

Gene name
UBQLN2, ALS15, CHAP1, DSK2, HRIHFB2157, N4BP4, PLIC2
Definition
(RefSeq) ubiquilin 2
  KO
K04523  
ubiquilin
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Disease
H00058  
Amyotrophic lateral sclerosis (ALS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    29978 (UBQLN2)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Proteasome interacting proteins (PIPs)
   UBL-UBA shuttle proteins
    29978 (UBQLN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q9UHD9(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
Xp11.21
AA seq 624 aa AA seqDB search
MAENGESSGPPRPSRGPAAAQGSAAAPAEPKIIKVTVKTPKEKEEFAVPENSSVQQFKEA
ISKRFKSQTDQLVLIFAGKILKDQDTLIQHGIHDGLTVHLVIKSQNRPQGQSTQPSNAAG
TNTTSASTPRSNSTPISTNSNPFGLGSLGGLAGLSSLGLSSTNFSELQSQMQQQLMASPE
MMIQIMENPFVQSMLSNPDLMRQLIMANPQMQQLIQRNPEISHLLNNPDIMRQTLEIARN
PAMMQEMMRNQDLALSNLESIPGGYNALRRMYTDIQEPMLNAAQEQFGGNPFASVGSSSS
SGEGTQPSRTENRDPLPNPWAPPPATQSSATTSTTTSTGSGSGNSSSNATGNTVAAANYV
ASIFSTPGMQSLLQQITENPQLIQNMLSAPYMRSMMQSLSQNPDLAAQMMLNSPLFTANP
QLQEQMRPQLPAFLQQMQNPDTLSAMSNPRAMQALMQIQQGLQTLATEAPGLIPSFTPGV
GVGVLGTAIGPVGPVTPIGPIGPIVPFTPIGPIGPIGPTGPAAPPGSTGSGGPTGPTVSS
AAPSETTSPTSESGPNQQFIQQMVQALAGANAPQLPNPEVRFQQQLEQLNAMGFLNREAN
LQALIATGGDINAAIERLLGSQPS
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaatggcgagagcagcggccccccgcgcccctcccgcggccctgctgcggcc
caaggctcggctgctgccccggctgagcctaaaatcatcaaagtcacggtgaagactccc
aaagagaaagaggagttcgcggtgcccgagaacagctcggttcagcagtttaaggaagcg
atttcgaaacgcttcaaatcccaaaccgatcagctagtgctgatttttgccggaaaaatc
ttaaaagatcaagataccttgatccagcatggcatccatgatgggctgactgttcacctt
gtcatcaaaagccagaaccgacctcagggccagtccacgcagcctagcaatgccgcggga
actaacactacctcggcgtcgactcccaggagtaactccacacctatttccacaaatagc
aacccgtttgggttggggagcctgggaggacttgcaggccttagcagcctgggcttgagc
tcgaccaacttctctgagctccagagccagatgcagcagcagcttatggccagccctgag
atgatgatccaaataatggaaaatccctttgttcagagcatgctttcgaatcccgatctg
atgaggcagctcattatggctaatccacagatgcagcaattgattcagagaaacccagaa
atcagtcacctgctcaacaacccagacataatgaggcagacactcgaaattgccaggaat
ccagccatgatgcaagagatgatgagaaatcaagacctggctcttagcaatctagaaagc
atcccaggtggctataatgctttacggcgcatgtacactgacattcaagagccgatgctg
aatgccgcacaagagcagtttgggggtaatccatttgcctccgtggggagtagttcctcc
tctggggaaggtacgcagccttcccgcacagaaaatcgcgatccactacccaatccatgg
gcaccaccgccagctacccagagttctgcaactaccagcacgaccacaagcactggtagt
gggtctggcaatagttccagcaatgctactgggaacaccgttgctgccgctaattatgtc
gccagcatctttagtaccccaggcatgcagagcctgctgcaacagataactgaaaacccc
cagctgattcagaatatgctgtcggcgccctacatgagaagcatgatgcagtcgctgagc
cagaatccagatttggctgcacagatgatgctgaatagcccgctgtttactgcaaatcct
cagctgcaggagcagatgcggccacagctcccagccttcctgcagcagatgcagaatcca
gacacactatcagccatgtcaaacccaagagcaatgcaggctttaatgcagatccagcag
gggctacagacattagccactgaagcacctggcctgattccgagcttcactccaggtgtg
ggggtgggggtgctgggaaccgctataggccctgtaggcccagtcacccccataggcccc
ataggccctatagtcccttttacccccataggccccattgggcccataggacccactggc
cctgcagccccccctggctccaccggctctggtggccccacggggcctactgtgtccagc
gctgcacctagtgaaaccacgagtcctacatcagaatctggacccaaccagcagttcatt
cagcaaatggtgcaggccctggctggagcaaatgctccacagctgccgaatccagaagtc
agatttcagcaacaactggaacagctcaacgcaatggggttcttaaaccgtgaagcaaac
ttgcaggccctaatagcaacaggaggcgacatcaatgcagccattgaaaggctgctgggc
tcccagccatcgtaa

DBGET integrated database retrieval system