KEGG   Homo sapiens (human): 29979Help
Entry
29979             CDS       T01001                                 

Gene name
UBQLN1, DA41, DSK2, PLIC-1, UBQN, XDRP1
Definition
(RefSeq) ubiquilin 1
  KO
K04523  
ubiquilin
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    29979 (UBQLN1)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Proteasome interacting proteins (PIPs)
   UBL-UBA shuttle proteins
    29979 (UBQLN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q9UMX0(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
9q21.32; 9q21.2-q21.3
AA seq 589 aa AA seqDB search
MAESGESGGPPGSQDSAAGAEGAGAPAAAASAEPKIMKVTVKTPKEKEEFAVPENSSVQQ
FKEEISKRFKSHTDQLVLIFAGKILKDQDTLSQHGIHDGLTVHLVIKTQNRPQDHSAQQT
NTAGSNVTTSSTPNSNSTSGSATSNPFGLGGLGGLAGLSSLGLNTTNFSELQSQMQRQLL
SNPEMMVQIMENPFVQSMLSNPDLMRQLIMANPQMQQLIQRNPEISHMLNNPDIMRQTLE
LARNPAMMQEMMRNQDRALSNLESIPGGYNALRRMYTDIQEPMLSAAQEQFGGNPFASLV
SNTSSGEGSQPSRTENRDPLPNPWAPQTSQSSSASSGTASTVGGTTGSTASGTSGQSTTA
PNLVPGVGASMFNTPGMQSLLQQITENPQLMQNMLSAPYMRSMMQSLSQNPDLAAQMMLN
NPLFAGNPQLQEQMRQQLPTFLQQMQNPDTLSAMSNPRAMQALLQIQQGLQTLATEAPGL
IPGFTPGLGALGSTGGSSGTNGSNATPSENTSPTAGTTEPGHQQFIQQMLQALAGVNPQL
QNPEVRFQQQLEQLSAMGFLNREANLQALIATGGDINAAIERLLGSQPS
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atggccgagagtggtgaaagcggcggtcctccgggctcccaggatagcgccgccggagcc
gaaggtgctggcgcccccgcggccgctgcctccgcggagcccaaaatcatgaaagtcacc
gtgaagaccccgaaggaaaaggaggaattcgccgtgcccgagaatagctccgtccagcag
tttaaggaagaaatctctaaacgttttaaatcacatactgaccaacttgtgttgatattt
gctggaaaaattttgaaagatcaagataccttgagtcagcatggaattcatgatggactt
actgttcaccttgtcattaaaacacaaaacaggcctcaggatcattcagctcagcaaaca
aatacagctggaagcaatgttactacatcatcaactcctaatagtaactctacatctggt
tctgctactagcaacccttttggtttaggtggccttgggggacttgcaggtctgagtagc
ttgggtttgaatactaccaacttctctgaactacagagtcagatgcagcgacaacttttg
tctaaccctgaaatgatggtccagatcatggaaaatccctttgttcagagcatgctctca
aatcctgacctgatgagacagttaattatggccaatccacaaatgcagcagttgatacag
agaaatccagaaattagtcatatgttgaataatccagatataatgagacaaacgttggaa
cttgccaggaatccagcaatgatgcaggagatgatgaggaaccaggaccgagctttgagc
aacctagaaagcatcccagggggatataatgctttaaggcgcatgtacacagatattcag
gaaccaatgctgagtgctgcacaagagcagtttggtggtaatccatttgcttccttggtg
agcaatacatcctctggtgaaggtagtcaaccttcccgtacagaaaatagagatccacta
cccaatccatgggctccacagacttcccagagttcatcagcttccagcggcactgccagc
actgtgggtggcactactggtagtactgccagtggcacttctgggcagagtactactgcg
ccaaatttggtgcctggagtaggagctagtatgttcaacacaccaggaatgcagagcttg
ttgcaacaaataactgaaaacccacaactgatgcaaaacatgttgtctgccccctacatg
agaagcatgatgcagtcactaagccagaatcctgaccttgctgcacagatgatgctgaat
aatcccctatttgctggaaatcctcagcttcaagaacaaatgagacaacagctcccaact
ttcctccaacaaatgcagaatcctgatacactatcagcaatgtcaaaccctagagcaatg
caggccttgttacagattcagcagggtttacagacattagcaacggaagccccgggcctc
atcccagggtttactcctggcttgggggcattaggaagcactggaggctcttcgggaact
aatggatctaacgccacacctagtgaaaacacaagtcccacagcaggaaccactgaacct
ggacatcagcagtttattcagcagatgctgcaggctcttgctggagtaaatcctcagcta
cagaatccagaagtcagatttcagcaacaactggaacaactcagtgcaatgggatttttg
aaccgtgaagcaaacttgcaagctctaatagcaacaggaggtgatatcaatgcagctatt
gaaaggttactgggctcccagccatcatag

DBGET integrated database retrieval system