KEGG   Homo sapiens (human): 29994Help
Entry
29994             CDS       T01001                                 

Gene name
BAZ2B, WALp4
Definition
(RefSeq) bromodomain adjacent to zinc finger domain 2B
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q24.2
AA seq 2168 aa AA seqDB search
MESGERLPSSAASSTTPTSSSTPSVASVVSKGGLSTGVASLSSTINPCGHLFRTAGDQPF
NLSTVSSAFPMVSHPVFGLHSASSGHSEFGGLGTLGTPTALAAHPQLASFPGAEWWRTTD
AHTRTGATFFPPLLGIPPLFAPPAQNHDSSSFHSRTSGKSNRNGPEKGVNGSINGSNTSS
VIGINTSVLSTTASSSMGQTKSTSSGGGNRKCNQEQSKNQPLDARVDKIKDKKPRKKAME
SSSNSDSDSGTSSDTSSEGISSSDSDDLEEDEEEEDQSIEESEDDDSDSESEAQHKSNNQ
VLLHGISDPKADGQKATEKAQEKRIHQPLPLASESQTHSFQSQQKQPQVLSQQLPFIFQS
SQAKEESVNKHTSVIQSTGLVSNVKPLSLVNQAKKETYMKLIVPSPDVLKAGNKNTSEES
SLLTSELRSKREQYKQAFPSQLKKQESSKSLKKVIAALSNPKATSSSPAHPKQTLENNHP
NPFLTNALLGNHQPNGVIQSVIQEAPLALTTKTKMQSKINENIAAASSTPFSSPVNLSTS
GRRTPGNQTPVMPSASPILHSQGKEKAVSNNVNPVKTQHHSHPAKSLVEQFRGTDSDIPS
SKDSEDSNEDEEEDDEEEDEEDDEDDESDDSQSESDSNSESDTEGSEEEDDDDKDQDESD
SDTEGEKTSMKLNKTTSSVKSPSMSLTGHSTPRNLHIAKAPGSAPAALCSESQSPAFLGT
SSSTLTSSPHSGTSKRRRVTDERELRIPLEYGWQRETRIRNFGGRLQGEVAYYAPCGKKL
RQYPEVIKYLSRNGIMDISRDNFSFSAKIRVGDFYEARDGPQGMQWCLLKEEDVIPRIRA
MEGRRGRPPNPDRQRAREESRMRRRKGRPPNVGNAEFLDNADAKLLRKLQAQEIARQAAQ
IKLLRKLQKQEQARVAKEAKKQQAIMAAEEKRKQKEQIKIMKQQEKIKRIQQIRMEKELR
AQQILEAKKKKKEEAANAKLLEAEKRIKEKEMRRQQAVLLKHQERERRRQHMMLMKAMEA
RKKAEEKERLKQEKRDEKRLNKERKLEQRRLELEMAKELKKPNEDMCLADQKPLPELPRI
PGLVLSGSTFSDCLMVVQFLRNFGKVLGFDVNIDVPNLSVLQEGLLNIGDSMGEVQDLLV
RLLSAAVCDPGLITGYKAKTALGEHLLNVGVNRDNVSEILQIFMEAHCGQTELTESLKTK
AFQAHTPAQKASVLAFLINELACSKSVVSEIDKNIDYMSNLRRDKWVVEGKLRKLRIIHA
KKTGKRDTSGGIDLGEEQHPLGTPTPGRKRRRKGGDSDYDDDDDDDSDDQGDEDDEDEED
KEDKKGKKTDICEDEDEGDQAASVEELEKQIEKLSKQQSQYRRKLFDASHSLRSVMFGQD
RYRRRYWILPQCGGIFVEGMESGEGLEEIAKEREKLKKAESVQIKEEMFETSGDSLNCSN
TDHCEQKEDLKEKDNTNLFLQKPGSFSKLSKLLEVAKMPPESEVMTPKPNAGANGCTLSY
QNSGKHSLGSVQSTATQSNVEKADSNNLFNTGSSGPGKFYSPLPNDQLLKTLTEKNRQWF
SLLPRTPCDDTSLTHADMSTASLVTPQSQPPSKSPSPTPAPLGSSAQNPVGLNPFALSPL
QVKGGVSMMGLQFCGWPTGVVTSNIPFTSSVPSLGSGLGLSEGNGNSFLTSNVASSKSES
PVPQNEKATSAQPAAVEVAKPVDFPSPKPIPEEMQFGWWRIIDPEDLKALLKVLHLRGIR
EKALQKQIQKHLDYITQACLKNKDVAIIELNENEENQVTRDIVENWSVEEQAMEMDLSVL
QQVEDLERRVASASLQVKGWMCPEPASEREDLVYFEHKSFTKLCKEHDGEFTGEDESSAH
ALERKSDNPLDIAVTRLADLERNIERRIEEDIAPGLRVWRRALSEARSAAQVALCIQQLQ
KSIAWEKSIMKVYCQICRKGDNEELLLLCDGCDKGCHTYCHRPKITTIPDGDWFCPACIA
KASGQTLKIKKLHVKGKKTNESKKGKKVTLTGDTEDEDSASTSSSLKRGNKDLKKRKMEE
NTSINLSKQESFTSVKKPKRDDSKDLALCSMILTEMETHEDAWPFLLPVNLKLVPGYKKV
IKKPMDFSTIREKLSSGQYPNLETFALDVRLVFDNCETFNEDDSDIGRAGHNMRKYFEKK
WTDTFKVS
NT seq 6507 nt NT seq  +upstreamnt  +downstreamnt
atggagtctggagaacggttaccatcctcagcagcctcctctactacaccaacttcatct
tcgacaccttctgtggcttcagtagtttcaaaaggtggcctttccactggagttgcttca
cttagctctacaatcaacccatgtggacatttattcagaacagctggggatcaaccgttt
aacctgtccacagtgtcgagtgccttcccaatggtcagccacccagtctttggtctacat
tcagccagctcagggcattcagaatttggtggtttggggacacttggtacacccacagcc
ttagccgcacatccccaactagcatcttttccaggtgcagaatggtggcgaacaactgat
gctcatactcgtacaggagcaaccttctttccaccattactgggaattccaccactattt
gctcccccagcccagaatcatgattcttcttcattccattcaaggacttcgggaaaaagt
aatcgaaatggtcccgaaaaaggtgtaaatgggtcaataaatggaagtaatacatcatct
gtaattggtatcaacacatctgtactatccactactgcttcaagttccatgggacaaact
aaaagtacaagctcaggtggaggaaatcgaaaatgtaatcaggaacaaagcaaaaaccag
cctttggatgctagagttgacaaaatcaaagataagaaaccaaggaagaaagcaatggaa
agttctagcaacagtgatagtgattcaggcacatcatcagacacctcaagtgaaggcatt
agtagcagtgattcagatgatctagaagaagatgaagaagaagaagatcaaagtattgaa
gaaagtgaagatgatgattctgattcagagagtgaagcacaacataaaagtaacaaccag
gtgctattacatggtatttcagacccaaaagcagatggacagaaagcaactgaaaaagcc
caggaaaaaagaatacaccagccattacctcttgcgtctgaatcccagactcactcattc
caatcccagcagaagcagcctcaggttttgtcacagcagcttccatttattttccaaagc
tctcaggcaaaggaggaatctgtgaacaaacacaccagtgtaatacagtctacgggattg
gtgtccaatgtgaaacctttatctttggtaaatcaagccaaaaaggaaacttacatgaaa
ctcatagttccttctcctgatgttcttaaagcagggaataaaaatacctctgaagaatct
agtttattgaccagtgaattgagatccaaacgggaacaatataaacaggcattcccatca
cagttaaagaaacaagagtcatcgaagagcctgaagaaggttattgcagctttgtcaaat
ccaaaagcaacctctagttcaccagcacatccaaaacaaacattagaaaacaaccaccca
aatccattcttgacaaatgcacttttaggtaatcaccaaccaaatggagttattcaaagt
gtcattcaagaagctcctctagcacttactaccaaaactaaaatgcagagcaagattaat
gaaaacattgctgctgcaagtagcacccctttttcctcacctgtaaatctgagtacaagt
gggagaagaacccctggcaatcagacacctgtaatgccctctgcctctcccatcctgcat
agtcaagggaaggaaaaagcagttagcaataatgtaaacccagtaaaaacacagcatcac
tcccatcctgcaaaatctttagtggaacaattcagaggaacagattcagacattcccagt
agtaaagattctgaagattcaaatgaggatgaagaggaagatgatgaagaagaagatgag
gaagatgatgaagatgatgaatctgatgacagccaatcagaatcagatagtaattcagaa
tcagatacagaaggatcagaagaagaagatgatgatgataaagaccaagatgaatcagat
agtgatactgaaggagagaaaacttcaatgaaactgaataaaacaacttcctctgtcaaa
agcccttccatgagtctcacaggtcactcaacacctcgtaacctccacatagcaaaagcc
ccaggctctgctcctgctgccttatgttctgaatcccagtcacctgcttttcttggtaca
tcttcttccacacttacttcaagcccacactctggcacttccaaaagaagaagagtaaca
gatgaacgtgaactgcgtattccattggaatatggctggcagagagagacaagaataaga
aactttggagggcgccttcaaggagaagtagcatattatgctccatgtggaaagaaactt
aggcagtaccctgaagtaataaagtatctcagcagaaatggaataatggatatctcaagg
gacaatttcagcttcagtgcaaaaataagagtgggtgacttctatgaagccagagatgga
ccgcagggaatgcagtggtgtcttttgaaagaagaggatgtcattcctcgtatcagggca
atggaaggtcgtagaggaagaccaccaaatccagatagacaacgagcaagagaggaatcc
aggatgagacgtcggaaaggtcgacctccaaatgttggcaatgctgaattcctagataac
gcagatgcaaagttgctaagaaaactgcaagctcaagaaatagccaggcaagcagcacaa
ataaagcttttgagaaaacttcaaaagcaggaacaggctcgggttgctaaagaagccaaa
aaacaacaagcaataatggctgctgaggagaagcggaagcaaaaagaacagataaagatt
atgaaacagcaggaaaaaattaagagaatacagcaaatcagaatggaaaaagaacttcga
gctcagcaaattctagaggctaaaaagaaaaagaaggaagaagcggcaaatgccaaatta
ttggaggccgagaaacgaataaaggaaaaagaaatgagaagacaacaagctgttcttctg
aaacatcaggaacgagagcgaaggcgacaacacatgatgcttatgaaagctatggaagct
cgtaaaaaagcagaagaaaaagagcggttgaaacaagaaaaacgtgatgagaaaagatta
aataaagagcgtaaactagagcagcgaagattagaattagaaatggcaaaggaactaaag
aagcctaatgaagacatgtgcttagcagaccaaaagcctttgccagagttgcctcgtatt
ccaggacttgttctctctggaagtacattttcagactgtctcatggtggtgcagttctta
cgaaactttggtaaagttttgggctttgatgtgaatattgatgttccaaacctgagtgtt
cttcaagagggattgctaaatataggggacagcatgggtgaagtacaagacttgcttgtg
aggctcctctcagctgctgtatgtgatccaggtctaataacaggatacaaggctaaaaca
gctcttggagaacatttgctgaatgttggtgtgaatcgagacaatgtttccgagatttta
cagatatttatggaagcccactgtggacaaactgagcttactgaaagtctgaagaccaaa
gcttttcaggctcacactccagcacagaaagcttcagtcctggctttcctgatcaatgaa
ctggcatgcagcaagagtgtggtcagtgaaatcgacaagaacattgattatatgtcaaac
ttgaggagagataaatgggtggtagaaggtaaactccgcaagctcagaatcattcatgct
aagaaaacaggcaaaagagacacttcaggtggcattgatctgggagaagagcagcatccc
ttgggcacacccactccaggacgcaagcgaagaaggaagggaggagacagtgattatgac
gatgatgatgacgatgacagtgatgaccaaggggatgaagatgatgaggatgaagaagat
aaagaagacaaaaaaggaaaaaagactgatatctgtgaagatgaggatgaaggtgaccaa
gcagcaagtgttgaagagctggaaaaacagattgaaaaactgagtaaacaacagagtcag
tacagaaggaagctctttgatgcgtctcactcattgcgttcagtgatgtttggccaagat
cgttacagacgccggtactggattcttccccaatgtggggggatttttgtagaaggcatg
gagagtggtgaaggactagaagaaattgcaaaagaaagagaaaaactgaaaaaggcagaa
agtgtccagatcaaagaagaaatgtttgagacttctggggacagtttaaattgttcaaat
acagatcactgtgaacaaaaggaagatcttaaagaaaaagataacacaaatctattcctt
cagaaacctggctctttttccaaattaagcaagcttttggaagtagctaagatgcctcct
gagtcagaggttatgacccccaaaccaaatgctggtgcaaatgggtgcacgttgtcttat
cagaacagtggaaaacattcactgggcagcgttcagtcaacagcaacgcaaagcaatgtg
gaaaaggcagactctaataatctgtttaatactggttcaagtggtccagggaagttctac
agtcctctccccaatgaccagttactaaaaacgctgactgaaaagaatagacaatggttt
agtcttttgccacgaacaccctgtgatgacacttcacttactcatgccgatatgtcaact
gcttctttggtgactcctcagtctcagccaccatctaagtcaccttcacctaccccagct
cctcttggatcttctgctcagaatcctgttggcttaaatccatttgctttatcacctctt
caggtgaaaggtggagtatctatgatgggacttcagttttgtggatggcccactggtgtg
gttacttctaatattccatttacatcatctgtacctagtctaggatcggggttagggtta
tcagaaggaaatggtaattcattcttgacttccaatgttgcttcaagtaaaagtgaatct
ccagtaccacagaatgaaaaggccacttcagctcaacctgcagctgttgaagtagcaaaa
ccagtagattttcctagtccaaaacctattccagaagaaatgcagtttggttggtggaga
attattgacccagaggacctaaaagctttgctcaaagtgctgcatctcagaggaataaga
gaaaaggcattacaaaaacaaattcagaaacatttggattatattactcaagcctgcctc
aagaataaggatgttgctattattgaactgaatgaaaatgaagaaaaccaagtaactcga
gatattgtggagaactggtcagtagaagaacaagcaatggaaatggatttgagtgtcctt
caacaggtagaagatctagaaaggagagttgcatcagcaagtttgcaagtgaagggttgg
atgtgtccagagcctgcatcagaaagggaggacttggtatattttgaacataaatcattt
actaaattgtgcaaggagcatgatggagaatttactggcgaagacgaaagcagtgcacat
gcactagaacggaagagtgacaaccccctagatatagctgtaaccaggctggctgatttg
gagcggaacattgaaagaagaattgaagaggatattgctccagggctcagggtatggaga
agggcattatcagaagctcgcagtgctgcacaggtagctctgtgcattcagcaattacag
aaatcaatagcatgggaaaaatcaattatgaaagtttactgccaaatctgtcgaaaggga
gataatgaagaactgcttcttctttgtgatggctgtgacaaaggctgtcatacctactgc
catagacccaagattacaacaatcccagatggagactggttttgtccagcttgcattgct
aaggcaagtggtcaaactctaaaaatcaaaaaacttcatgtcaaaggaaaaaagactaat
gagtcaaagaaaggcaagaaggtaactttaacaggagatactgaagatgaagactctgca
tctacaagtagttcactaaaaagaggaaacaaagacctcaagaaaagaaaaatggaggaa
aacacttctattaacttgtcaaaacaagaaagttttacttcagttaagaaacctaaaaga
gatgactccaaggacctagctctttgcagtatgattctgactgaaatggaaactcatgag
gatgcatggccttttctacttcctgtaaacttgaaacttgttcctggttataagaaagtt
attaagaagcctatggatttttccacaattagagagaaactaagtagtggacagtatcca
aaccttgaaacctttgctctagatgtcaggcttgtttttgacaactgtgaaacatttaat
gaagatgattctgatataggcagagctggccacaatatgaggaagtattttgaaaaaaag
tggacagatactttcaaagtgagctga

DBGET integrated database retrieval system