KEGG   Homo sapiens (human): 29994Help
Entry
29994             CDS       T01001                                 

Gene name
BAZ2B, WALp4
Definition
(RefSeq) bromodomain adjacent to zinc finger domain 2B
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9UIF8(Tchem)
UniProt: 
Structure
PDB: 
5PG1 5PFM 5PGB 5PGJ 5PGA 4QF3 4QC3 5PGC 5PG9 5PDG 5PFW 5PGS 5PB8 5PBX 5PCV 5PE5 5PE8 5PEA 5PFA 5PFP 5PFY 5PG6 5E9Y 5DYU 5CQ8 5PB7 5PEI 5PFH 5PFI 5PG3 5PBM 5PE6 5PDF 5PFG 5PG2 5PGG 5PBH 5PCM 5PCP 5PD3 5PD7 5PDV 5PDX 5PEG 5PG8 5PBZ 5PCW 5PDI 5PDP 5PDR 5PDU 5PEL 5PEO 5PEZ 5PGE 4IR5 5PD8 5PDM 5PDN 5PE2 5PEH 5PEJ 5PF5 5PFL 5PG0 5PGQ 5E73 5PBG 5PC1 5PC7 5PE9 5PEN 5PET 5PFN 5PFV 5PFZ 5PGT 5PEF 5PBV 5PC6 5PDC 5PDK 5PE4 5PBY 5PCH 5PCK 5PCU 5PEE 5PEQ 5PF6 5PFC 5PFU 5PG5 5CUD 4XUA 5PC9 5PCD 5PE0 5PE3 5PGP 5PBC 5PBK 5PBS 5PCO 5PDA 5PDD 5PEW 5PB9 5PBB 5PBD 5PBI 5PCT 5PDH 5PDO 5PDS 5PF1 5PF8 5PFQ 5E9M 5E74 5CUG 5CQ4 4CUS 5PBJ 5PBT 5PC0 5PC2 5PCX 5PD1 5PD2 5PDT 5PEK 5PEX 5PF7 5PFE 5PGD 5PGN 5PBF 5PC3 5PCB 5PD4 5PDB 5PDL 5PED 5PES 5PEY 5PFB 4CUU 4IR6 5PBR 5PE7 5PEV 5PFO 5PGF 5PCC 5PCS 5PF3 5PGK 5PBE 5PBL 5PBW 5PCA 5PCN 5PCZ 5PD0 5PDJ 4CUR 4CUT 5PC5 5PC8 5PEC 5L8T 5L8U 5DYX 5CUC 4NRA 5PBN 5PC4 5PD9 5CQ7 4NRC 5PBP 5PBU 5PCI 5PDE 5PDW 5PFD 5PGI 5PGO 4CUP 5PD5 5PF2 5PFR 5CUA 5PCR 5PDZ 5PEU 5PFX 5MGF 5E9L 5PE1 5PF9 5PBA 5PBQ 5PDY 5PGH 5CQ3 5PBO 5PF0 5MGE 5PFF 5PG7 5E9I 5CQ5 5PCJ 5PEM 5CQ6 5PCG 4XUB 4RVR 4NR9 4QC1 5OR9 5PER 5PFS 5PGR 5L99 4IR3 5PD6 5PF4 5PCF 5PFT 3G0L 5L97 5CU8 4IR4 3Q2F 5PFJ 5E9K 5CUE 4NRB 5ORB 5MGG 5CUB 5PEB 4CUQ 5CQA 5L96 5PCE 5PCL 5PGL 5PDQ 5L98 5PCQ 5PG4 2E7O
Thumbnails

Jmol
Position
2q24.2
AA seq 2168 aa AA seqDB search
MESGERLPSSAASSTTPTSSSTPSVASVVSKGGLSTGVASLSSTINPCGHLFRTAGDQPF
NLSTVSSAFPMVSHPVFGLHSASSGHSEFGGLGTLGTPTALAAHPQLASFPGAEWWRTTD
AHTRTGATFFPPLLGIPPLFAPPAQNHDSSSFHSRTSGKSNRNGPEKGVNGSINGSNTSS
VIGINTSVLSTTASSSMGQTKSTSSGGGNRKCNQEQSKNQPLDARVDKIKDKKPRKKAME
SSSNSDSDSGTSSDTSSEGISSSDSDDLEEDEEEEDQSIEESEDDDSDSESEAQHKSNNQ
VLLHGISDPKADGQKATEKAQEKRIHQPLPLASESQTHSFQSQQKQPQVLSQQLPFIFQS
SQAKEESVNKHTSVIQSTGLVSNVKPLSLVNQAKKETYMKLIVPSPDVLKAGNKNTSEES
SLLTSELRSKREQYKQAFPSQLKKQESSKSLKKVIAALSNPKATSSSPAHPKQTLENNHP
NPFLTNALLGNHQPNGVIQSVIQEAPLALTTKTKMQSKINENIAAASSTPFSSPVNLSTS
GRRTPGNQTPVMPSASPILHSQGKEKAVSNNVNPVKTQHHSHPAKSLVEQFRGTDSDIPS
SKDSEDSNEDEEEDDEEEDEEDDEDDESDDSQSESDSNSESDTEGSEEEDDDDKDQDESD
SDTEGEKTSMKLNKTTSSVKSPSMSLTGHSTPRNLHIAKAPGSAPAALCSESQSPAFLGT
SSSTLTSSPHSGTSKRRRVTDERELRIPLEYGWQRETRIRNFGGRLQGEVAYYAPCGKKL
RQYPEVIKYLSRNGIMDISRDNFSFSAKIRVGDFYEARDGPQGMQWCLLKEEDVIPRIRA
MEGRRGRPPNPDRQRAREESRMRRRKGRPPNVGNAEFLDNADAKLLRKLQAQEIARQAAQ
IKLLRKLQKQEQARVAKEAKKQQAIMAAEEKRKQKEQIKIMKQQEKIKRIQQIRMEKELR
AQQILEAKKKKKEEAANAKLLEAEKRIKEKEMRRQQAVLLKHQERERRRQHMMLMKAMEA
RKKAEEKERLKQEKRDEKRLNKERKLEQRRLELEMAKELKKPNEDMCLADQKPLPELPRI
PGLVLSGSTFSDCLMVVQFLRNFGKVLGFDVNIDVPNLSVLQEGLLNIGDSMGEVQDLLV
RLLSAAVCDPGLITGYKAKTALGEHLLNVGVNRDNVSEILQIFMEAHCGQTELTESLKTK
AFQAHTPAQKASVLAFLINELACSKSVVSEIDKNIDYMSNLRRDKWVVEGKLRKLRIIHA
KKTGKRDTSGGIDLGEEQHPLGTPTPGRKRRRKGGDSDYDDDDDDDSDDQGDEDDEDEED
KEDKKGKKTDICEDEDEGDQAASVEELEKQIEKLSKQQSQYRRKLFDASHSLRSVMFGQD
RYRRRYWILPQCGGIFVEGMESGEGLEEIAKEREKLKKAESVQIKEEMFETSGDSLNCSN
TDHCEQKEDLKEKDNTNLFLQKPGSFSKLSKLLEVAKMPPESEVMTPKPNAGANGCTLSY
QNSGKHSLGSVQSTATQSNVEKADSNNLFNTGSSGPGKFYSPLPNDQLLKTLTEKNRQWF
SLLPRTPCDDTSLTHADMSTASLVTPQSQPPSKSPSPTPAPLGSSAQNPVGLNPFALSPL
QVKGGVSMMGLQFCGWPTGVVTSNIPFTSSVPSLGSGLGLSEGNGNSFLTSNVASSKSES
PVPQNEKATSAQPAAVEVAKPVDFPSPKPIPEEMQFGWWRIIDPEDLKALLKVLHLRGIR
EKALQKQIQKHLDYITQACLKNKDVAIIELNENEENQVTRDIVENWSVEEQAMEMDLSVL
QQVEDLERRVASASLQVKGWMCPEPASEREDLVYFEHKSFTKLCKEHDGEFTGEDESSAH
ALERKSDNPLDIAVTRLADLERNIERRIEEDIAPGLRVWRRALSEARSAAQVALCIQQLQ
KSIAWEKSIMKVYCQICRKGDNEELLLLCDGCDKGCHTYCHRPKITTIPDGDWFCPACIA
KASGQTLKIKKLHVKGKKTNESKKGKKVTLTGDTEDEDSASTSSSLKRGNKDLKKRKMEE
NTSINLSKQESFTSVKKPKRDDSKDLALCSMILTEMETHEDAWPFLLPVNLKLVPGYKKV
IKKPMDFSTIREKLSSGQYPNLETFALDVRLVFDNCETFNEDDSDIGRAGHNMRKYFEKK
WTDTFKVS
NT seq 6507 nt NT seq  +upstreamnt  +downstreamnt
atggagtctggagaacggttaccatcctcagcagcctcctctactacaccaacttcatct
tcgacaccttctgtggcttcagtagtttcaaaaggtggcctttccactggagttgcttca
cttagctctacaatcaacccatgtggacatttattcagaacagctggggatcaaccgttt
aacctgtccacagtgtcgagtgccttcccaatggtcagccacccagtctttggtctacat
tcagccagctcagggcattcagaatttggtggtttggggacacttggtacacccacagcc
ttagccgcacatccccaactagcatcttttccaggtgcagaatggtggcgaacaactgat
gctcatactcgtacaggagcaaccttctttccaccattactgggaattccaccactattt
gctcccccagcccagaatcatgattcttcttcattccattcaaggacttcgggaaaaagt
aatcgaaatggtcccgaaaaaggtgtaaatgggtcaataaatggaagtaatacatcatct
gtaattggtatcaacacatctgtactatccactactgcttcaagttccatgggacaaact
aaaagtacaagctcaggtggaggaaatcgaaaatgtaatcaggaacaaagcaaaaaccag
cctttggatgctagagttgacaaaatcaaagataagaaaccaaggaagaaagcaatggaa
agttctagcaacagtgatagtgattcaggcacatcatcagacacctcaagtgaaggcatt
agtagcagtgattcagatgatctagaagaagatgaagaagaagaagatcaaagtattgaa
gaaagtgaagatgatgattctgattcagagagtgaagcacaacataaaagtaacaaccag
gtgctattacatggtatttcagacccaaaagcagatggacagaaagcaactgaaaaagcc
caggaaaaaagaatacaccagccattacctcttgcgtctgaatcccagactcactcattc
caatcccagcagaagcagcctcaggttttgtcacagcagcttccatttattttccaaagc
tctcaggcaaaggaggaatctgtgaacaaacacaccagtgtaatacagtctacgggattg
gtgtccaatgtgaaacctttatctttggtaaatcaagccaaaaaggaaacttacatgaaa
ctcatagttccttctcctgatgttcttaaagcagggaataaaaatacctctgaagaatct
agtttattgaccagtgaattgagatccaaacgggaacaatataaacaggcattcccatca
cagttaaagaaacaagagtcatcgaagagcctgaagaaggttattgcagctttgtcaaat
ccaaaagcaacctctagttcaccagcacatccaaaacaaacattagaaaacaaccaccca
aatccattcttgacaaatgcacttttaggtaatcaccaaccaaatggagttattcaaagt
gtcattcaagaagctcctctagcacttactaccaaaactaaaatgcagagcaagattaat
gaaaacattgctgctgcaagtagcacccctttttcctcacctgtaaatctgagtacaagt
gggagaagaacccctggcaatcagacacctgtaatgccctctgcctctcccatcctgcat
agtcaagggaaggaaaaagcagttagcaataatgtaaacccagtaaaaacacagcatcac
tcccatcctgcaaaatctttagtggaacaattcagaggaacagattcagacattcccagt
agtaaagattctgaagattcaaatgaggatgaagaggaagatgatgaagaagaagatgag
gaagatgatgaagatgatgaatctgatgacagccaatcagaatcagatagtaattcagaa
tcagatacagaaggatcagaagaagaagatgatgatgataaagaccaagatgaatcagat
agtgatactgaaggagagaaaacttcaatgaaactgaataaaacaacttcctctgtcaaa
agcccttccatgagtctcacaggtcactcaacacctcgtaacctccacatagcaaaagcc
ccaggctctgctcctgctgccttatgttctgaatcccagtcacctgcttttcttggtaca
tcttcttccacacttacttcaagcccacactctggcacttccaaaagaagaagagtaaca
gatgaacgtgaactgcgtattccattggaatatggctggcagagagagacaagaataaga
aactttggagggcgccttcaaggagaagtagcatattatgctccatgtggaaagaaactt
aggcagtaccctgaagtaataaagtatctcagcagaaatggaataatggatatctcaagg
gacaatttcagcttcagtgcaaaaataagagtgggtgacttctatgaagccagagatgga
ccgcagggaatgcagtggtgtcttttgaaagaagaggatgtcattcctcgtatcagggca
atggaaggtcgtagaggaagaccaccaaatccagatagacaacgagcaagagaggaatcc
aggatgagacgtcggaaaggtcgacctccaaatgttggcaatgctgaattcctagataac
gcagatgcaaagttgctaagaaaactgcaagctcaagaaatagccaggcaagcagcacaa
ataaagcttttgagaaaacttcaaaagcaggaacaggctcgggttgctaaagaagccaaa
aaacaacaagcaataatggctgctgaggagaagcggaagcaaaaagaacagataaagatt
atgaaacagcaggaaaaaattaagagaatacagcaaatcagaatggaaaaagaacttcga
gctcagcaaattctagaggctaaaaagaaaaagaaggaagaagcggcaaatgccaaatta
ttggaggccgagaaacgaataaaggaaaaagaaatgagaagacaacaagctgttcttctg
aaacatcaggaacgagagcgaaggcgacaacacatgatgcttatgaaagctatggaagct
cgtaaaaaagcagaagaaaaagagcggttgaaacaagaaaaacgtgatgagaaaagatta
aataaagagcgtaaactagagcagcgaagattagaattagaaatggcaaaggaactaaag
aagcctaatgaagacatgtgcttagcagaccaaaagcctttgccagagttgcctcgtatt
ccaggacttgttctctctggaagtacattttcagactgtctcatggtggtgcagttctta
cgaaactttggtaaagttttgggctttgatgtgaatattgatgttccaaacctgagtgtt
cttcaagagggattgctaaatataggggacagcatgggtgaagtacaagacttgcttgtg
aggctcctctcagctgctgtatgtgatccaggtctaataacaggatacaaggctaaaaca
gctcttggagaacatttgctgaatgttggtgtgaatcgagacaatgtttccgagatttta
cagatatttatggaagcccactgtggacaaactgagcttactgaaagtctgaagaccaaa
gcttttcaggctcacactccagcacagaaagcttcagtcctggctttcctgatcaatgaa
ctggcatgcagcaagagtgtggtcagtgaaatcgacaagaacattgattatatgtcaaac
ttgaggagagataaatgggtggtagaaggtaaactccgcaagctcagaatcattcatgct
aagaaaacaggcaaaagagacacttcaggtggcattgatctgggagaagagcagcatccc
ttgggcacacccactccaggacgcaagcgaagaaggaagggaggagacagtgattatgac
gatgatgatgacgatgacagtgatgaccaaggggatgaagatgatgaggatgaagaagat
aaagaagacaaaaaaggaaaaaagactgatatctgtgaagatgaggatgaaggtgaccaa
gcagcaagtgttgaagagctggaaaaacagattgaaaaactgagtaaacaacagagtcag
tacagaaggaagctctttgatgcgtctcactcattgcgttcagtgatgtttggccaagat
cgttacagacgccggtactggattcttccccaatgtggggggatttttgtagaaggcatg
gagagtggtgaaggactagaagaaattgcaaaagaaagagaaaaactgaaaaaggcagaa
agtgtccagatcaaagaagaaatgtttgagacttctggggacagtttaaattgttcaaat
acagatcactgtgaacaaaaggaagatcttaaagaaaaagataacacaaatctattcctt
cagaaacctggctctttttccaaattaagcaagcttttggaagtagctaagatgcctcct
gagtcagaggttatgacccccaaaccaaatgctggtgcaaatgggtgcacgttgtcttat
cagaacagtggaaaacattcactgggcagcgttcagtcaacagcaacgcaaagcaatgtg
gaaaaggcagactctaataatctgtttaatactggttcaagtggtccagggaagttctac
agtcctctccccaatgaccagttactaaaaacgctgactgaaaagaatagacaatggttt
agtcttttgccacgaacaccctgtgatgacacttcacttactcatgccgatatgtcaact
gcttctttggtgactcctcagtctcagccaccatctaagtcaccttcacctaccccagct
cctcttggatcttctgctcagaatcctgttggcttaaatccatttgctttatcacctctt
caggtgaaaggtggagtatctatgatgggacttcagttttgtggatggcccactggtgtg
gttacttctaatattccatttacatcatctgtacctagtctaggatcggggttagggtta
tcagaaggaaatggtaattcattcttgacttccaatgttgcttcaagtaaaagtgaatct
ccagtaccacagaatgaaaaggccacttcagctcaacctgcagctgttgaagtagcaaaa
ccagtagattttcctagtccaaaacctattccagaagaaatgcagtttggttggtggaga
attattgacccagaggacctaaaagctttgctcaaagtgctgcatctcagaggaataaga
gaaaaggcattacaaaaacaaattcagaaacatttggattatattactcaagcctgcctc
aagaataaggatgttgctattattgaactgaatgaaaatgaagaaaaccaagtaactcga
gatattgtggagaactggtcagtagaagaacaagcaatggaaatggatttgagtgtcctt
caacaggtagaagatctagaaaggagagttgcatcagcaagtttgcaagtgaagggttgg
atgtgtccagagcctgcatcagaaagggaggacttggtatattttgaacataaatcattt
actaaattgtgcaaggagcatgatggagaatttactggcgaagacgaaagcagtgcacat
gcactagaacggaagagtgacaaccccctagatatagctgtaaccaggctggctgatttg
gagcggaacattgaaagaagaattgaagaggatattgctccagggctcagggtatggaga
agggcattatcagaagctcgcagtgctgcacaggtagctctgtgcattcagcaattacag
aaatcaatagcatgggaaaaatcaattatgaaagtttactgccaaatctgtcgaaaggga
gataatgaagaactgcttcttctttgtgatggctgtgacaaaggctgtcatacctactgc
catagacccaagattacaacaatcccagatggagactggttttgtccagcttgcattgct
aaggcaagtggtcaaactctaaaaatcaaaaaacttcatgtcaaaggaaaaaagactaat
gagtcaaagaaaggcaagaaggtaactttaacaggagatactgaagatgaagactctgca
tctacaagtagttcactaaaaagaggaaacaaagacctcaagaaaagaaaaatggaggaa
aacacttctattaacttgtcaaaacaagaaagttttacttcagttaagaaacctaaaaga
gatgactccaaggacctagctctttgcagtatgattctgactgaaatggaaactcatgag
gatgcatggccttttctacttcctgtaaacttgaaacttgttcctggttataagaaagtt
attaagaagcctatggatttttccacaattagagagaaactaagtagtggacagtatcca
aaccttgaaacctttgctctagatgtcaggcttgtttttgacaactgtgaaacatttaat
gaagatgattctgatataggcagagctggccacaatatgaggaagtattttgaaaaaaag
tggacagatactttcaaagtgagctga

DBGET integrated database retrieval system