KEGG   Homo sapiens (human): 30Help
Entry
30                CDS       T01001                                 

Gene name
ACAA1, ACAA, PTHIO, THIO
Definition
acetyl-CoA acyltransferase 1 (EC:2.3.1.16)
Orthology
K07513  
acetyl-CoA acyltransferase 1 [EC:2.3.1.16]
Organism
hsa  Homo sapiens (human)
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
alpha-Linolenic acid metabolism
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Fatty acid metabolism
PPAR signaling pathway
Peroxisome
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    30 (ACAA1)
  Lipid metabolism
   00071 Fatty acid degradation
    30 (ACAA1)
   00592 alpha-Linolenic acid metabolism
    30 (ACAA1)
   01040 Biosynthesis of unsaturated fatty acids
    30 (ACAA1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    30 (ACAA1)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    30 (ACAA1)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    30 (ACAA1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     30 (ACAA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3p22.2
AA seq 331 aa AA seqDB search
MQRLQVVLGHLRGPADSGWMPQAAPCLSGAPQASAADVVVVHGRRTAICRAGRGGFKDTT
PDELLSAVMTAVLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVN
RQCSSGLQAVASIAGGIRNGSYDIGMACGITSENVAERFGISREKQDTFALASQQKAARA
QSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAG
LTVSDVDIFEINEAFASQAAYCVEKLRLPPEKVNPLGGAVALGHPLGCTGARQVITLLNE
LKRRGKRAYGVVSMCIGTGMGAAAVFEYPGN
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgcagaggctgcaggtagtgctgggccacctgaggggtccggccgattccggctggatg
ccgcaggccgcgccttgcctgagcggtgccccgcaggcctcggccgcggacgtggtggtg
gtgcacgggcggcgcacggccatctgccgggcgggccgcggcggcttcaaggacaccacc
cccgacgagcttctctcggcagtcatgaccgcggttctcaaggacgtgaatctgaggccg
gaacagctgggggacatctgtgtcggaaatgtgctgcagcctggggccggggcaatcatg
gcccgaatcgcccagtttctgagtgacatcccggagactgtgcctttgtccactgtcaat
agacagtgttcgtcggggctacaggcagtggccagcatagcaggtggcatcagaaatggg
tcttatgacattggcatggcctgtgggataacctctgagaatgtggctgagcggtttggc
atttcacgggagaagcaggatacctttgccctggcttcccagcagaaggcagcaagagcc
cagagcaagggctgtttccaagctgagattgtgcctgtgaccaccacggtccatgatgac
aagggcaccaagaggagcatcactgtgacccaggatgagggtatccgccccagcaccacc
atggagggcctggccaaactgaagcctgccttcaagaaagatggttctaccacagctggg
ctgacagtgagtgacgtggacatcttcgagatcaatgaggcctttgcaagccaggctgcc
tactgtgtggagaagctacgactcccccctgagaaggtgaaccccctggggggtgcagtg
gccttagggcacccactgggctgcactggggcacgacaggtcatcacgctgctcaatgag
ctgaagcgccgtgggaagagggcatacggagtggtgtccatgtgcatcgggactggaatg
ggagccgctgccgtctttgaataccctgggaactga

DBGET integrated database retrieval system