KEGG   Homo sapiens (human): 30Help
Entry
30                CDS       T01001                                 

Gene name
ACAA1, ACAA, PTHIO, THIO
Definition
acetyl-CoA acyltransferase 1 (EC:2.3.1.16)
Orthology
K07513  
acetyl-CoA acyltransferase 1 [EC:2.3.1.16]
Organism
hsa  Homo sapiens (human)
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
alpha-Linolenic acid metabolism
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Fatty acid metabolism
PPAR signaling pathway
Peroxisome
Module
beta-Oxidation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:hsa01212]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:hsa00071]
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:hsa00592]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:hsa01040]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:hsa00280]
Cellular Processes; Transport and catabolism; Peroxisome [PATH:hsa04146]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:hsa03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3p22.2
AA seq 331 aa AA seqDB search
MQRLQVVLGHLRGPADSGWMPQAAPCLSGAPQASAADVVVVHGRRTAICRAGRGGFKDTT
PDELLSAVMTAVLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVN
RQCSSGLQAVASIAGGIRNGSYDIGMACGITSENVAERFGISREKQDTFALASQQKAARA
QSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAG
LTVSDVDIFEINEAFASQAAYCVEKLRLPPEKVNPLGGAVALGHPLGCTGARQVITLLNE
LKRRGKRAYGVVSMCIGTGMGAAAVFEYPGN
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgcagaggctgcaggtagtgctgggccacctgaggggtccggccgattccggctggatg
ccgcaggccgcgccttgcctgagcggtgccccgcaggcctcggccgcggacgtggtggtg
gtgcacgggcggcgcacggccatctgccgggcgggccgcggcggcttcaaggacaccacc
cccgacgagcttctctcggcagtcatgaccgcggttctcaaggacgtgaatctgaggccg
gaacagctgggggacatctgtgtcggaaatgtgctgcagcctggggccggggcaatcatg
gcccgaatcgcccagtttctgagtgacatcccggagactgtgcctttgtccactgtcaat
agacagtgttcgtcggggctacaggcagtggccagcatagcaggtggcatcagaaatggg
tcttatgacattggcatggcctgtgggataacctctgagaatgtggctgagcggtttggc
atttcacgggagaagcaggatacctttgccctggcttcccagcagaaggcagcaagagcc
cagagcaagggctgtttccaagctgagattgtgcctgtgaccaccacggtccatgatgac
aagggcaccaagaggagcatcactgtgacccaggatgagggtatccgccccagcaccacc
atggagggcctggccaaactgaagcctgccttcaagaaagatggttctaccacagctggg
ctgacagtgagtgacgtggacatcttcgagatcaatgaggcctttgcaagccaggctgcc
tactgtgtggagaagctacgactcccccctgagaaggtgaaccccctggggggtgcagtg
gccttagggcacccactgggctgcactggggcacgacaggtcatcacgctgctcaatgag
ctgaagcgccgtgggaagagggcatacggagtggtgtccatgtgcatcgggactggaatg
ggagccgctgccgtctttgaataccctgggaactga

DBGET integrated database retrieval system