KEGG   Homo sapiens (human): 3000Help
Entry
3000              CDS       T01001                                 

Gene name
GUCY2D, CORD5, CORD6, CYGD, GUC1A4, GUC2D, LCA, LCA1, RCD2, RETGC-1, ROS-GC1, ROSGC, retGC
Definition
guanylate cyclase 2D, membrane (retina-specific) (EC:4.6.1.2)
Orthology
K12321  
guanylate cyclase 2D/E/F [EC:4.6.1.2]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Olfactory transduction
Phototransduction
Disease
H00481  
Cone-rod dystrophy and cone dystrophy
H00837  
Leber congenital amaurosis (LCR)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    3000 (GUCY2D)
 Organismal Systems
  Sensory system
   04744 Phototransduction
    3000 (GUCY2D)
   04740 Olfactory transduction
    3000 (GUCY2D)
Enzymes [BR:hsa01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     3000 (GUCY2D)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: RGC group
  RGC family [OT]
   3000 (GUCY2D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17p13.1
AA seq 1103 aa AA seqDB search
MTACARRAGGLPDPGLCGPAWWAPSLPRLPRALPRLPLLLLLLLLQPPALSAVFTVGVLG
PWACDPIFSRARPDLAARLAAARLNRDPGLAGGPRFEVALLPEPCRTPGSLGAVSSALAR
VSGLVGPVNPAACRPAELLAEEAGIALVPWGCPWTQAEGTTAPAVTPAADALYALLRAFG
WARVALVTAPQDLWVEAGRSLSTALRARGLPVASVTSMEPLDLSGAREALRKVRDGPRVT
AVIMVMHSVLLGGEEQRYLLEAAEELGLTDGSLVFLPFDTIHYALSPGPEALAALANSSQ
LRRAHDAVLTLTRHCPSEGSVLDSLRRAQERRELPSDLNLQQVSPLFGTIYDAVFLLARG
VAEARAAAGGRWVSGAAVARHIRDAQVPGFCGDLGGDEEPPFVLLDTDAAGDRLFATYML
DPARGSFLSAGTRMHFPRGGSAPGPDPSCWFDPNNICGGGLEPGLVFLGFLLVVGMGLAG
AFLAHYVRHRLLHMQMVSGPNKIILTVDDITFLHPHGGTSRKVAQGSRSSLGARSMSDIR
SGPSQHLDSPNIGVYEGDRVWLKKFPGDQHIAIRPATKTAFSKLQELRHENVALYLGLFL
ARGAEGPAALWEGNLAVVSEHCTRGSLQDLLAQREIKLDWMFKSSLLLDLIKGIRYLHHR
GVAHGRLKSRNCIVDGRFVLKITDHGHGRLLEAQKVLPEPPRAEDQLWTAPELLRDPALE
RRGTLAGDVFSLAIIMQEVVCRSAPYAMLELTPEEVVQRVRSPPPLCRPLVSMDQAPVEC
ILLMKQCWAEQPELRPSMDHTFDLFKNINKGRKTNIIDSMLRMLEQYSSNLEDLIRERTE
ELELEKQKTDRLLTQMLPPSVAEALKTGTPVEPEYFEQVTLYFSDIVGFTTISAMSEPIE
VVDLLNDLYTLFDAIIGSHDVYKVETIGDAYMVASGLPQRNGQRHAAEIANMSLDILSAV
GTFRMRHMPEVPVRIRIGLHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHV
NLSTVGILRALDSGYQVELRGRTELKGKGAEDTFWLVGRRGFNKPIPKPPDLQPGSSNHG
ISLQEIPPERRRKLEKARPGQFS
NT seq 3312 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcctgcgcccgccgagcgggtgggcttccggaccccgggctctgcggtcccgcg
tggtgggctccgtccctgccccgcctcccccgggccctgccccggctcccgctcctgctg
ctcctgcttctgctgcagccccccgccctctccgccgtgttcacggtgggggtcctgggc
ccctgggcttgcgaccccatcttctctcgggctcgcccggacctggccgcccgcctggcc
gccgcccgcctgaaccgcgaccccggcctggcaggcggtccccgcttcgaggtagcgctg
ctgcccgagccttgccggacgccgggctcgctgggggccgtgtcctccgcgctggcccgc
gtgtcgggcctcgtgggtccggtgaaccctgcggcctgccggccagccgagctgctcgcc
gaagaagccgggatcgcgctggtgccctggggctgcccctggacgcaggcggagggcacc
acggcccctgccgtgacccccgccgcggatgccctctacgccctgcttcgcgcattcggc
tgggcgcgcgtggccctggtcaccgccccccaggacctgtgggtggaggcgggacgctca
ctgtccacggcactcagggcccggggcctgcctgtcgcctccgtgacttccatggagccc
ttggacctgtctggagcccgggaggccctgaggaaggttcgggacgggcccagggtcaca
gcagtgatcatggtgatgcactcggtgctgctgggtggcgaggagcagcgctacctcctg
gaggccgcagaggagctgggcctgaccgatggctccctggtcttcctgcccttcgacacg
atccactacgccttgtccccaggcccggaggccttggccgcactcgccaacagctcccag
cttcgcagggcccacgatgccgtgctcaccctcacgcgccactgtccctctgaaggcagc
gtgctggacagcctgcgcagggctcaagagcgccgcgagctgccctctgacctcaatctg
cagcaggtctccccactctttggcaccatctatgacgcggtcttcttgctggcaaggggc
gtggcagaagcgcgggctgccgcaggtggcagatgggtgtccggagcagctgtggcccgc
cacatccgggatgcgcaggtccctggcttctgcggggacctaggaggagacgaggagccc
ccattcgtgctgctagacacggacgcggcgggagaccggctttttgccacatacatgctg
gatcctgcccggggctccttcctctccgccggtacccggatgcacttcccgcgtggggga
tcagcacccggacctgacccctcgtgctggttcgatccaaacaacatctgcggtggagga
ctggagccgggcctcgtctttcttggcttcctcctggtggttgggatggggctggctggg
gccttcctggcccattatgtgaggcaccggctacttcacatgcaaatggtctccggcccc
aacaagatcatcctgaccgtggacgacatcacctttctccacccacatgggggcacctct
cgaaaggtggcccaggggagtcgatcaagtctgggtgcccgcagcatgtcagacattcgc
agcggccccagccaacacttggacagccccaacattggtgtctatgagggagacagggtt
tggctgaagaaattcccaggggatcagcacatagctatccgcccagcaaccaagacggcc
ttctccaagctccaggagctccggcatgagaacgtggccctctacctggggcttttcctg
gctcggggagcagaaggccctgcggccctctgggagggcaacctggctgtggtctcagag
cactgcacgcggggctctcttcaggacctcctcgctcagagagaaataaagctggactgg
atgttcaagtcctccctcctgctggaccttatcaagggaataaggtatctgcaccatcga
ggcgtggctcatgggcggctgaagtcacggaactgcatagtggatggcagattcgtactc
aagatcactgaccacggccacgggagactgctggaagcacagaaggtgctaccggagcct
cccagagcggaggaccagctgtggacagccccggagctgcttagggacccagccctggag
cgccggggaacgctggccggcgacgtctttagcttggccatcatcatgcaagaagtagtg
tgccgcagtgccccttatgccatgctggagctcactcccgaggaagtggtgcagagggtg
cggagcccccctccactgtgtcggcccttggtgtccatggaccaggcacctgtcgagtgt
atcctcctgatgaagcagtgctgggcagagcagccggaacttcggccctccatggaccac
accttcgacctgttcaagaacatcaacaagggccggaagacgaacatcattgactcgatg
cttcggatgctggagcagtactctagtaacctggaggatctgatccgggagcgcacggag
gagctggagctggaaaagcagaagacagaccggctgcttacacagatgctgcctccgtct
gtggctgaggccttgaagacggggacaccagtggagcccgagtactttgagcaagtgaca
ctgtactttagtgacattgtgggcttcaccaccatctctgccatgagtgagcccattgag
gttgtggacctgctcaacgatctctacacactctttgatgccatcattggttcccacgat
gtctacaaggtggagacaataggggacgcctatatggtggcctcggggctgccccagcgg
aatgggcagcgacacgcggcagagatcgccaacatgtcactggacatcctcagtgccgtg
ggcactttccgcatgcgccatatgcctgaggttcccgtgcgcatccgcataggcctgcac
tcgggtccatgcgtggcaggcgtggtgggcctcaccatgccgcggtactgcctgtttggg
gacacggtcaacaccgcctcgcgcatggagtccaccgggctgccttaccgcatccacgtg
aacttgagcactgtggggattctccgtgctctggactcgggctaccaggtggagctgcga
ggccgcacggagctgaagggcaagggcgccgaggacactttctggctagtgggcagacgc
ggcttcaacaagcccatccccaaaccgcctgacctgcaaccggggtccagcaaccacggc
atcagcctgcaggagatcccacccgagcggcgacggaagctggagaaggcgcggccgggc
cagttctcttga

DBGET integrated database retrieval system