KEGG   Homo sapiens (human): 30001Help
Entry
30001             CDS       T01001                                 

Gene name
ERO1A, ERO1-L, ERO1-L-alpha, ERO1-alpha, ERO1L, ERO1LA, Ero1alpha
Definition
(RefSeq) endoplasmic reticulum oxidoreductase 1 alpha
  KO
K10950  
ERO1-like protein alpha [EC:1.8.4.-]
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Vibrio cholerae infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    30001 (ERO1A)
 Human Diseases
  Infectious diseases
   05110 Vibrio cholerae infection
    30001 (ERO1A)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     30001 (ERO1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q22.1
AA seq 468 aa AA seqDB search
MGRGWGFLFGLLGAVWLLSSGHGEEQPPETAAQRCFCQVSGYLDDCTCDVETIDRFNNYR
LFPRLQKLLESDYFRYYKVNLKRPCPFWNDISQCGRRDCAVKPCQSDEVPDGIKSASYKY
SEEANNLIEECEQAERLGAVDESLSEETQKAVLQWTKHDDSSDNFCEADDIQSPEAEYVD
LLLNPERYTGYKGPDAWKIWNVIYEENCFKPQTIKRPLNPLASGQGTSEENTFYSWLEGL
CVEKRAFYRLISGLHASINVHLSARYLLQETWLEKKWGHNITEFQQRFDGILTEGEGPRR
LKNLYFLYLIELRALSKVLPFFERPDFQLFTGNKIQDEENKMLLLEILHEIKSFPLHFDE
NSFFAGDKKEAHKLKEDFRLHFRNISRIMDCVGCFKCRLWGKLQTQGLGTALKILFSEKL
IANMPESGPSYEFHLTRQEIVSLFNAFGRISTSVKELENFRNLLQNIH
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgggccgcggctggggattcttgtttggcctcctgggcgccgtgtggctgctcagctcg
ggccacggagaggagcagcccccggagacagcggcacagaggtgcttctgccaggttagt
ggttacttggatgattgtacctgtgatgttgaaaccattgatagatttaataactacagg
cttttcccaagactacaaaaacttcttgaaagtgactactttaggtattacaaggtaaac
ctgaagaggccgtgtcctttctggaatgacatcagccagtgtggaagaagggactgtgct
gtcaaaccatgtcaatctgatgaagttcctgatggaattaaatctgcgagctacaagtat
tctgaagaagccaataatctcattgaagaatgtgaacaagctgaacgacttggagcagtg
gatgaatctctgagtgaggaaacacagaaggctgttcttcagtggaccaagcatgatgat
tcttcagataacttctgtgaagctgatgacattcagtcccctgaagctgaatatgtagat
ttgcttcttaatcctgagcgctacactggttacaagggaccagatgcttggaaaatatgg
aatgtcatctacgaagaaaactgttttaagccacagacaattaaaagacctttaaatcct
ttggcttctggtcaagggacaagtgaagagaacactttttacagttggctagaaggtctc
tgtgtagaaaaaagagcattctacagacttatatctggcctacatgcaagcattaatgtg
catttgagtgcaagatatcttttacaagagacctggttagaaaagaaatggggacacaac
attacagaatttcaacagcgatttgatggaattttgactgaaggagaaggtccaagaagg
cttaagaacttgtattttctctacttaatagaactaagggctttatccaaagtgttacca
ttcttcgagcgcccagattttcaactctttactggaaataaaattcaggatgaggaaaac
aaaatgttacttctggaaatacttcatgaaatcaagtcatttcctttgcattttgatgag
aattcattttttgctggggataaaaaagaagcacacaaactaaaggaggactttcgactg
cattttagaaatatttcaagaattatggattgtgttggttgttttaaatgtcgtctgtgg
ggaaagcttcagactcagggtttgggcactgctctgaagatcttattttctgagaaattg
atagcaaatatgccagaaagtggacctagttatgaattccatctaaccagacaagaaata
gtatcattattcaacgcatttggaagaatttctacaagtgtgaaagaattagaaaacttc
aggaacttgttacagaatattcattaa

DBGET integrated database retrieval system