KEGG   Homo sapiens (human): 3001Help
Entry
3001              CDS       T01001                                 

Gene name
GZMA, CTLA3, HFSP
Definition
(RefSeq) granzyme A (EC:3.4.21.78)
  KO
K01352  
granzyme A [EC:3.4.21.78]
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3001 (GZMA)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.78  granzyme A
     3001 (GZMA)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   3001 (GZMA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q11-q12
AA seq 262 aa AA seqDB search
MRNSYRFLASSLSVVVSLLLIPEDVCEKIIGGNEVTPHSRPYMVLLSLDRKTICAGALIA
KDWVLTAAHCNLNKRSQVILGAHSITREEPTKQIMLVKKEFPYPCYDPATREGDLKLLQL
TEKAKINKYVTILHLPKKGDDVKPGTMCQVAGWGRTHNSASWSDTLREVNITIIDRKVCN
DRNHYNFNPVIGMNMVCAGSLRGGRDSCNGDSGSPLLCEGVFRGVTSFGLENKCGDPRGP
GVYILLSKKHLNWIIMTIKGAV
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaggaactcctatagatttctggcatcctctctctcagttgtcgtttctctcctgcta
attcctgaagatgtctgtgaaaaaattattggaggaaatgaagtaactcctcattcaaga
ccctacatggtcctacttagtcttgacagaaaaaccatctgtgctggggctttgattgca
aaagactgggtgttgactgcagctcactgtaacttgaacaaaaggtcccaggtcattctt
ggggctcactcaataaccagggaagagccaacaaaacagataatgcttgttaagaaagag
tttccctatccatgctatgacccagccacacgcgaaggtgaccttaaacttttacagctg
acggaaaaagcaaaaattaacaaatatgtgactatccttcatctacctaaaaagggggat
gatgtgaaaccaggaaccatgtgccaagttgcagggtggggcaggactcacaatagtgca
tcttggtccgatactctgagagaagtcaatatcaccatcatagacagaaaagtctgcaat
gatcgaaatcactataattttaaccctgtgattggaatgaatatggtttgtgctggaagc
ctccgaggtggaagagactcgtgcaatggagattctggaagccctttgttgtgcgagggt
gttttccgaggggtcacttcctttggccttgaaaataaatgcggagaccctcgtgggcct
ggtgtctatattcttctctcaaagaaacacctcaactggataattatgactatcaaggga
gcagtttaa

DBGET integrated database retrieval system