KEGG   Homo sapiens (human): 30011Help
Entry
30011             CDS       T01001                                 

Gene name
SH3KBP1, CD2BP3, CIN85, GIG10, HSB-1, HSB1, MIG18
Definition
(RefSeq) SH3 domain containing kinase binding protein 1
  KO
K12470  
SH3 domain-containing kinase-binding protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    30011 (SH3KBP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xp22.1-p21.3
AA seq 665 aa AA seqDB search
MVEAIVEFDYQAQHDDELTISVGEIITNIRKEDGGWWEGQINGRRGLFPDNFVREIKKEM
KKDPLTNKAPEKPLHEVPSGNSLLSSETILRTNKRGERRRRRCQVAFSYLPQNDDELELK
VGDIIEVVGEVEEGWWEGVLNGKTGMFPSNFIKELSGESDELGISQDEQLSKSSLRETTG
SESDGGDSSSTKSEGANGTVATAAIQPKKVKGVGFGDIFKDKPIKLRPRSIEVENDFLPV
EKTIGKKLPATTATPDSSKTEMDSRTKSKDYCKVIFPYEAQNDDELTIKEGDIVTLINKD
CIDVGWWEGELNGRRGVFPDNFVKLLPPDFEKEGNRPKKPPPPSAPVIKQGAGTTERKHE
IKKIPPERPEMLPNRTEEKERPEREPKLDLQKPSVPAIPPKKPRPPKTNSLSRPGALPPR
RPERPVGPLTHTRGDSPKIDLAGSSLSGILDKDLSDRSNDIDLEGFDSVVSSTEKLSHPT
TSRPKATGRRPPSQSLTSSSLSSPDIFDSPSPEEDKEEHISLAHRGVDASKKTSKTVTIS
QVSDNKASLPPKPGTMAAGGGGPAPLSSAAPSPLSSSLGTAGHRANSPSLFGTEGKPKME
PAASSQAAVEELRTQVRELRSIIETMKDQQKREIKQLLSELDEEKKIRLRLQMEVNDIKK
ALQSK
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atggtggaggccatagtggagtttgactaccaggcccagcacgatgatgagctgacgatc
agcgtgggtgaaatcatcaccaacatcaggaaggaggatggaggctggtgggagggacag
atcaacggcaggagaggtttgttccctgacaactttgtaagagaaataaagaaagagatg
aagaaagaccctctcaccaacaaagctccagaaaagcccctgcacgaagtgcccagtgga
aactctttgctgtcttctgaaacgattttaagaaccaataagagaggcgagcgacggagg
cgccggtgccaggtggcattcagctacctgccccagaatgacgatgaacttgagctgaaa
gttggcgacatcatagaggtggtaggagaggtagaggaaggatggtgggaaggtgttctc
aacgggaagactggaatgtttccttccaacttcatcaaggagctgtcaggggagtcggat
gagcttggcatttcccaggatgagcagctatccaagtcaagtttaagggaaaccacaggc
tccgagagtgatgggggtgactcaagcagcaccaagtctgaaggtgccaacgggacagtg
gcaactgcagcaatccagcccaagaaagttaagggagtgggctttggagacattttcaaa
gacaagccaatcaaactaagaccaaggtcaattgaagtagaaaatgactttctgccggta
gaaaagactattgggaagaagttacctgcaactacagcaactccagactcatcaaaaaca
gaaatggacagcaggacaaagagcaaggattactgcaaagtaatatttccatatgaggca
cagaatgatgatgaattgacaatcaaagaaggagatatagtcactctcatcaataaggac
tgcatcgacgtaggctggtgggaaggagagctgaacggcagacgaggcgtgttccccgat
aacttcgtgaagttacttccaccggactttgaaaaggaagggaatagacccaagaagcca
ccgcctccatccgctcctgtcatcaaacaaggggcaggcaccactgagagaaaacatgaa
attaaaaagatacctcctgaaagaccagaaatgcttccaaacagaacagaagaaaaagaa
agaccagagagagagccaaaactggatttacagaagccctccgttcctgccataccgcca
aaaaagcctcggccacctaagaccaattctctcagcagacctggcgcactgcccccgaga
aggccggagagaccggtgggtccgctgacacacaccaggggtgacagtccaaagattgac
ttggccggcagttcgctatctggcatcctggacaaagatctctcggaccgcagcaatgac
attgacttagaaggttttgactccgtggtatcatctactgagaaactcagtcatccgacc
acaagcagaccaaaagctacagggaggcggcctccgtcccagtccctcacatcttcatcc
ctttcaagccctgatatcttcgactccccaagtcccgaagaggataaggaggaacacatt
tcacttgcgcacagaggagtggacgcgtcaaagaaaacttccaagactgttaccatatcc
caagtgtctgacaacaaagcatccctgccgcccaagccggggaccatggcagcaggtggc
ggtgggccagcccctctgtcctcagcggcgccctcccccctgtcatcctctttgggaaca
gctggacacagagccaactccccgtctctgttcggcacggaaggaaaaccaaagatggag
cctgcggccagcagccaggcggccgtggaggagctaaggacacaggtccgcgagctgagg
agcatcatcgagaccatgaaggaccagcagaaacgagagattaaacagttattgtctgag
ttggatgaagagaagaaaatccggcttcggttgcagatggaagtgaacgacataaagaaa
gctctacaatcaaaatga

DBGET integrated database retrieval system