KEGG   Homo sapiens (human): 3002Help
Entry
3002              CDS       T01001                                 

Gene name
GZMB, CCPI, CGL-1, CGL1, CSP-B, CSPB, CTLA1, CTSGL1, HLP, SECT
Definition
(RefSeq) granzyme B (EC:3.4.21.79)
  KO
K01353  
granzyme B [EC:3.4.21.79]
Organism
hsa  Homo sapiens (human)
Pathway
Apoptosis
Natural killer cell mediated cytotoxicity
Type I diabetes mellitus
Transcriptional misregulation in cancer
Autoimmune thyroid disease
Allograft rejection
Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    3002 (GZMB)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    3002 (GZMB)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    3002 (GZMB)
  Immune diseases
   05320 Autoimmune thyroid disease
    3002 (GZMB)
   05330 Allograft rejection
    3002 (GZMB)
   05332 Graft-versus-host disease
    3002 (GZMB)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    3002 (GZMB)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.79  granzyme B
     3002 (GZMB)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   3002 (GZMB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q11.2
AA seq 247 aa AA seqDB search
MQPILLLLAFLLLPRADAGEIIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVL
TAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKR
TRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHY
YDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWI
KKTMKRY
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccaatcctgcttctgctggccttcctcctgctgcccagggcagatgcaggggag
atcatcgggggacatgaggccaagccccactcccgcccctacatggcttatcttatgatc
tgggatcagaagtctctgaagaggtgcggtggcttcctgatacgagacgacttcgtgctg
acagctgctcactgttggggaagctccataaatgtcaccttgggggcccacaatatcaaa
gaacaggagccgacccagcagtttatccctgtgaaaagacccatcccccatccagcctat
aatcctaagaacttctccaacgacatcatgctactgcagctggagagaaaggccaagcgg
accagagctgtgcagcccctcaggctacctagcaacaaggcccaggtgaagccagggcag
acatgcagtgtggccggctgggggcagacggcccccctgggaaaacactcacacacacta
caagaggtgaagatgacagtgcaggaagatcgaaagtgcgaatctgacttacgccattat
tacgacagtaccattgagttgtgcgtgggggacccagagattaaaaagacttcctttaag
ggggactctggaggccctcttgtgtgtaacaaggtggcccagggcattgtctcctatgga
cgaaacaatggcatgcctccacgagcctgcaccaaagtctcaagctttgtacactggata
aagaaaaccatgaaacgctactaa

DBGET integrated database retrieval system