KEGG   Homo sapiens (human): 30061Help
Entry
30061             CDS       T01001                                 

Gene name
SLC40A1, FPN1, HFE4, IREG1, MST079, MSTP079, MTP1, SLC11A3
Definition
(RefSeq) solute carrier family 40 member 1
  KO
K14685  
solute carrier family 40 (iron-regulated transporter), member 1
Organism
hsa  Homo sapiens (human)
Pathway
Mineral absorption
Disease
H00211  
Hemochromatosis (HFE)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04978 Mineral absorption
    30061 (SLC40A1)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC40: Basolateral iron transporter
   30061 (SLC40A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q32
AA seq 571 aa AA seqDB search
MTRAGDHNRQRGCCGSLADYLTSAKFLLYLGHSLSTWGDRMWHFAVSVFLVELYGNSLLL
TAVYGLVVAGSVLVLGAIIGDWVDKNARLKVAQTSLVVQNVSVILCGIILMMVFLHKHEL
LTMYHGWVLTSCYILIITIANIANLASTATAITIQRDWIVVVAGEDRSKLANMNATIRRI
DQLTNILAPMAVGQIMTFGSPVIGCGFISGWNLVSMCVEYVLLWKVYQKTPALAVKAGLK
EEETELKQLNLHKDTEPKPLEGTHLMGVKDSNIHELEHEQEPTCASQMAEPFRTFRDGWV
SYYNQPVFLAGMGLAFLYMTVLGFDCITTGYAYTQGLSGSILSILMGASAITGIMGTVAF
TWLRRKCGLVRTGLISGLAQLSCLILCVISVFMPGSPLDLSVSPFEDIRSRFIQGESITP
TKIPEITTEIYMSNGSNSANIVPETSPESVPIISVSLLFAGVIAARIGLWSFDLTVTQLL
QENVIESERGIINGVQNSMNYLLDLLHFIMVILAPNPEAFGLLVLISVSFVAMGHIMYFR
FAQNTLGNKLFACGPDAKEVRKENQANTSVV
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgaccagggcgggagatcacaaccgccagagaggatgctgtggatccttggccgactac
ctgacctctgcaaaattccttctctaccttggtcattctctctctacttggggagatcgg
atgtggcactttgcggtgtctgtgtttctggtagagctctatggaaacagcctccttttg
acagcagtctacgggctggtggtggcagggtctgttctggtcctgggagccatcatcggt
gactgggtggacaagaatgctagacttaaagtggcccagacctcgctggtggtacagaat
gtttcagtcatcctgtgtggaatcatcctgatgatggttttcttacataaacatgagctt
ctgaccatgtaccatggatgggttctcacttcctgctatatcctgatcatcactattgca
aatattgcaaatttggccagtactgctactgcaatcacaatccaaagggattggattgtt
gttgttgcaggagaagacagaagcaaactagcaaatatgaatgccacaatacgaaggatt
gaccagttaaccaacatcttagcccccatggctgttggccagattatgacatttggctcc
ccagtcatcggctgtggctttatttcgggatggaacttggtatccatgtgcgtggagtac
gttctgctctggaaggtttaccagaaaaccccagctctagctgtgaaagctggtcttaaa
gaagaggaaactgaattgaaacagctgaatttacacaaagatactgagccaaaacccctg
gagggaactcatctaatgggtgtgaaagactctaacatccatgagcttgaacatgagcaa
gagcctacttgtgcctcccagatggctgagcccttccgtaccttccgagatggatgggtc
tcctactacaaccagcctgtgtttctggctggcatgggtcttgctttcctttatatgact
gtcctgggctttgactgcatcaccacagggtacgcctacactcagggactgagtggttcc
atcctcagtattttgatgggagcatcagctataactggaataatgggaactgtagctttt
acttggctacgtcgaaaatgtggtttggttcggacaggtctgatctcaggattggcacag
ctttcctgtttgatcttgtgtgtgatctctgtattcatgcctggaagccccctggacttg
tccgtttctccttttgaagatatccgatcaaggttcattcaaggagagtcaattacacct
accaagatacctgaaattacaactgaaatatacatgtctaatgggtctaattctgctaat
attgtcccggagacaagtcctgaatctgtgcccataatctctgtcagtctgctgtttgca
ggcgtcattgctgctagaatcggtctttggtcctttgatttaactgtgacacagttgctg
caagaaaatgtaattgaatctgaaagaggcattataaatggtgtacagaactccatgaac
tatcttcttgatcttctgcatttcatcatggtcatcctggctccaaatcctgaagctttt
ggcttgctcgtattgatttcagtctcctttgtggcaatgggccacattatgtatttccga
tttgcccaaaatactctgggaaacaagctctttgcttgcggtcctgatgcaaaagaagtt
aggaaggaaaatcaagcaaatacatctgttgtttga

DBGET integrated database retrieval system