KEGG   Homo sapiens (human): 3028Help
Entry
3028              CDS       T01001                                 

Gene name
HSD17B10, 17b-HSD10, ABAD, CAMR, DUPXp11.22, ERAB, HADH2, HCD2, MHBD, MRPP2, MRX17, MRX31, MRXS10, SCHAD, SDR5C1
Definition
hydroxysteroid (17-beta) dehydrogenase 10 (EC:1.1.1.35 1.1.1.178 1.1.1.51)
Orthology
K08683  
3-hydroxyacyl-CoA dehydrogenase / 3-hydroxy-2-methylbutyryl-CoA dehydrogenase [EC:1.1.1.35 1.1.1.178]
Organism
hsa  Homo sapiens (human)
Pathway
Valine, leucine and isoleucine degradation
Metabolic pathways
Alzheimer's disease
Disease
H00480  
Non-syndromic X-linked mental retardation
H00658  
Syndromic X-linked mental retardation
H00925  
2-Methyl-3-hydroxybutyryl-CoA dehydrogenase (MHBD) deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    3028 (HSD17B10)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    3028 (HSD17B10)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     3028 (HSD17B10)
    1.1.1.178  3-hydroxy-2-methylbutyryl-CoA dehydrogenase
     3028 (HSD17B10)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial ribonuclease P
    3028 (HSD17B10)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   3028 (HSD17B10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xp11.2
AA seq 252 aa AA seqDB search
MAAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVF
APADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDV
NLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTL
PIARDLAPIGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGE
VIRLDGAIRMQP
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagcgtgtcggagcgtgaagggcctggtggcggtaataaccggaggagcctcg
ggcctgggcctggccacggcggagcgacttgtggggcagggagcctctgctgtgcttctg
gacctgcccaactcgggtggggaggcccaagccaagaagttaggaaacaactgcgttttc
gccccagccgacgtgacctctgagaaggatgtgcaaacagctctggctctagcaaaagga
aagtttggccgtgtggatgtagctgtcaactgtgcaggcatcgcggtggctagcaagacg
tacaacttaaagaagggccagacccataccttggaagacttccagcgagttcttgatgtg
aatctcatgggcaccttcaatgtgatccgcctggtggctggtgagatgggccagaatgaa
ccagaccagggaggccaacgtggggtcatcatcaacactgccagtgtggctgccttcgag
ggtcaggttggacaagctgcatactctgcttccaaggggggaatagtgggcatgacactg
cccattgctcgggatctggctcccataggtctgtttggcaccccactgctgaccagcctc
ccagagaaagtgtgcaacttcttggccagccaagtgcccttccctagccgactgggtgac
cctgctgagtatgctcacctcgtacaggccatcatcgagaacccattcctcaatggagag
gtcatccggctggatggggccattcgtatgcagccttga

DBGET integrated database retrieval system