KEGG   Homo sapiens (human): 3035Help
Entry
3035              CDS       T01001                                 

Gene name
HARS, HRS, USH3B
Definition
histidyl-tRNA synthetase (EC:6.1.1.21)
Orthology
K01892  
histidyl-tRNA synthetase [EC:6.1.1.21]
Organism
hsa  Homo sapiens (human)
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, eukaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:hsa00970]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q31.3
AA seq 469 aa AA seqDB search
MAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPK
ETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLTNIKRYHIAKVYRRDN
PAMTRGRYREFYQCDFDIAGNFDPMIPDAECLKIMCEILSSLQIGDFLVKVNDRRILDGM
FAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLV
EQLLQDPKLSQNKQALEGLGDLKLLFEYLTLFGIDDKISFDLSLARGLDYYTGVIYEAVL
LQTPAQAGEEPLGVGSVAAGGRYDGLVGMFDPKGRKVPCVGLSIGVERIFSIVEQRLEAL
EEKIRTTETQVLVASAQKKLLEERLKLVSELWDAGIKAELLYKKNPKLLNQLQYCEEAGI
PLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTGQPLCIC
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggcagagcgtgcggcgctggaggagctggtgaaacttcagggagagcgcgtgcgaggc
ctcaagcagcagaaggccagcgccgagctgatcgaggaggaggtggcgaaactcctgaaa
ctgaaggcacagctgggtcctgatgaaagcaaacagaaatttgtgctcaaaacccccaag
gaaacactgatgggaaagtatggggaagactccaagcttatctatgacctgaaggaccag
ggcggggagctcctgtcccttcgctatgacctcactgttccttttgctcggtatttggca
atgaataaactgaccaacattaaacgctaccacatagcaaaggtatatcggcgggataac
ccagccatgacccgtggccgataccgggaattctaccagtgtgattttgacattgctggg
aactttgatcccatgatccctgatgcagagtgcctgaagatcatgtgcgagatcctgagt
tcacttcagataggcgacttcctggtcaaggtaaacgatcgacgcattctagatgggatg
tttgctatctgtggtgtttctgacagcaagttccgtaccatctgctcctcagtagacaag
ctggacaaggtgtcctgggaagaggtgaagaatgagatggtgggagagaagggccttgca
cctgaggtggctgaccgcattggggactatgtccagcaacatggtggggtatccctggtg
gaacagctgctccaggatcctaaactatcccaaaacaagcaggccttggagggcctggga
gacctgaagttgctctttgagtacctgaccctatttggcattgatgacaaaatctccttt
gacctgagccttgctcgagggctggattactacactggggtgatctatgaggcagtgctg
ctacagaccccagcccaggcaggggaagagcccctgggtgtgggcagtgtggctgctgga
ggacgctatgatgggctagtgggcatgttcgaccccaaagggcgcaaggtgccatgtgtg
gggctcagcattggggtggagcggattttctccatcgtggaacagagactagaggctttg
gaggagaagatacggaccacggagacacaggtgcttgtggcatctgcacagaagaagctg
ctagaggaaagactaaagcttgtctcagaactgtgggatgctgggatcaaggctgagctg
ctgtacaagaagaacccaaagctactgaaccagttacagtactgtgaggaggcaggcatc
ccactggtggctatcatcggcgagcaggaactcaaggatggggtcatcaagctccgttca
gtgacgagcagggaagaggtggatgtccgaagagaagaccttgtggaggaaatcaaaagg
agaacaggccagcccctctgcatctgctga

DBGET integrated database retrieval system