KEGG   Homo sapiens (human): 3036Help
Entry
3036              CDS       T01001                                 

Gene name
HAS1, HAS
Definition
(RefSeq) hyaluronan synthase 1
  KO
K00752  hyaluronan synthase [EC:2.4.1.212]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.212  hyaluronan synthase
     3036 (HAS1)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  O-Glycan
   3036 (HAS1)
Transporters [BR:hsa02000]
 Other Transporters
  Others
   3036 (HAS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_tranf_2_3 Chitin_synth_2 Glyco_trans_2_3 Glycos_transf_2 Glyco_transf_21
Motif
Other DBs
NCBI-GeneID: 3036
NCBI-ProteinID: NP_001514
OMIM: 601463
HGNC: 4818
Ensembl: ENSG00000105509
Vega: OTTHUMG00000183499
Pharos: Q92839(Tbio)
UniProt: Q92839 Q8IYH3 D2N2G5
Position
19q13.41
AA seq 578 aa AA seqDB search
MRQQDAPKPTPAACRCSGLARRVLTIAFALLILGLMTWAYAAGVPLASDRYGLLAFGLYG
AFLSAHLVAQSLFAYLEHRRVAAAARGPLDAATARSVALTISAYQEDPAYLRQCLASARA
LLYPRARLRVLMVVDGNRAEDLYMVDMFREVFADEDPATYVWDGNYHQPWEPAAAGAVGA
GAYREVEAEDPGRLAVEALVRTRRCVCVAQRWGGKREVMYTAFKALGDSVDYVQVCDSDT
RLDPMALLELVRVLDEDPRVGAVGGDVRILNPLDSWVSFLSSLRYWVAFNVERACQSYFH
CVSCISGPLGLYRNNLLQQFLEAWYNQKFLGTHCTFGDDRHLTNRMLSMGYATKYTSRSR
CYSETPSSFLRWLSQQTRWSKSYFREWLYNALWWHRHHAWMTYEAVVSGLFPFFVAATVL
RLFYAGRPWALLWVLLCVQGVALAKAAFAAWLRGCLRMVLLSLYAPLYMCGLLPAKFLAL
VTMNQSGWGTSGRRKLAANYVPLLPLALWALLLLGGLVRSVAHEARADWSGPSRAAEAYH
LAAGAGAYVGYWVAMLTLYWVGVRRLCRRRTGGYRVQV
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgagacagcaggacgcgcccaagcccactcctgcagcctgccgctgctccggcctggcc
cggagggtgctgaccatcgccttcgccctgctcatcctgggcctcatgacctgggcctac
gccgccggggtgccgctggcctccgatcgctacggcctcctggccttcggcctctacggg
gccttcctttcagcgcacctggtggcgcagagcctcttcgcgtacctggagcaccggcgg
gtggcggcggcggcgcgggggccgctggatgcagccaccgcgcgcagtgtggcgctgacc
atctccgcctaccaggaggaccccgcgtacctgcgccagtgcctggcgtccgcccgcgcc
ctgctgtacccgcgcgcgcggctgcgcgtcctcatggtggtggatggcaaccgcgccgag
gacctctacatggtcgacatgttccgcgaggtcttcgctgacgaggaccccgccacgtac
gtgtgggacggcaactaccaccagccctgggaacccgcggcggcgggcgcggtgggcgcc
ggagcctatcgggaggtggaggcggaggatcctgggcggctggcagtggaggcgctggtg
aggactcgcaggtgcgtgtgcgtggcgcagcgctggggcggcaagcgcgaggtcatgtac
acagccttcaaggcgctcggagattcggtggactacgtgcaggtctgtgactcggacaca
aggttggaccccatggcactgctggagctcgtgcgggtactggacgaggacccccgggta
ggggctgttggtggggacgtgcggatccttaaccctctggactcctgggtcagcttccta
agcagcctgcgatactgggtagccttcaatgtggagcgggcttgtcagagctacttccac
tgtgtatcctgcatcagcggtcctctaggcctatataggaataacctcttgcagcagttt
cttgaggcctggtacaaccagaagttcctgggtacccactgtacttttggggatgaccgg
cacctcaccaaccgcatgctcagcatgggttatgctaccaagtacacctccaggtcccgc
tgctactcagagacgccctcgtccttcctgcggtggctgagccagcagacacgctggtcc
aagtcgtacttccgtgagtggctgtacaacgcgctctggtggcaccggcaccatgcgtgg
atgacctacgaggcggtggtctccggcctgttccccttcttcgtggcggccactgtgctg
cgtctgttctacgcgggccgcccttgggcgctgctgtgggtgctgctgtgcgtgcagggc
gtggcactggccaaggcggccttcgcggcctggctgcggggctgcctgcgcatggtgctt
ctgtcgctctacgcgcccctctacatgtgtggcctcctgcctgccaagttcctggcgcta
gtcaccatgaaccagagtggctggggcacctcgggccggcggaagctggccgctaactac
gtccctctgctgcccctggcgctctgggcgctgctgctgcttgggggcctggtccgcagc
gtagcacacgaggccagggccgactggagcggcccttcccgcgcagccgaggcctaccac
ttggccgcgggggccggcgcctacgtgggctactgggtggccatgttgacgctgtactgg
gtgggcgtgcggaggctttgccggcggcggaccgggggctaccgcgtccaggtgtga

DBGET integrated database retrieval system