KEGG   Homo sapiens (human): 3053Help
Entry
3053              CDS       T01001                                 

Gene name
SERPIND1, D22S673, HC2, HCF2, HCII, HLS2, LS2, THPH10
Definition
serpin peptidase inhibitor, clade D (heparin cofactor), member 1
Orthology
K03912  
heparin cofactor II
Organism
hsa  Homo sapiens (human)
Pathway
Complement and coagulation cascades
Disease
H00223  
Inherited thrombophilia
Class
Organismal Systems; Immune system; Complement and coagulation cascades [PATH:hsa04610]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
22q11.21
AA seq 499 aa AA seqDB search
MKHSLNALLIFLIITSAWGGSKGPLDQLEKGGETAQSADPQWEQLNNKNLSMPLLPADFH
KENTVTNDWIPEGEEDDDYLDLEKIFSEDDDYIDIVDSLSVSPTDSDVSAGNILQLFHGK
SRIQRLNILNAKFAFNLYRVLKDQVNTFDNIFIAPVGISTAMGMISLGLKGETHEQVHSI
LHFKDFVNASSKYEITTIHNLFRKLTHRLFRRNFGYTLRSVNDLYIQKQFPILLDFKTKV
REYYFAEAQIADFSDPAFISKTNNHIMKLTKGLIKDALENIDPATQMMILNCIYFKGSWV
NKFPVEMTHNHNFRLNEREVVKVSMMQTKGNFLAANDQELDCDILQLEYVGGISMLIVVP
HKMSGMKTLEAQLTPRVVERWQKSMTNRTREVLLPKFKLEKNYNLVESLKLMGIRMLFDK
NGNMAGISDQRIAIDLFKHQGTITVNEEGTQATTVTTVGFMPLSTQVRFTVDRPFLFLIY
EHRTSCLLFMGRVANPSRS
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaaacactcattaaacgcacttctcattttcctcatcataacatctgcgtggggtggg
agcaaaggcccgctggatcagctagagaaaggaggggaaactgctcagtctgcagatccc
cagtgggagcagttaaataacaaaaacctgagcatgcctcttctccctgccgacttccac
aaggaaaacaccgtcaccaacgactggattccagagggggaggaggacgacgactatctg
gacctggagaagatattcagtgaagacgacgactacatcgacatcgtcgacagtctgtca
gtttccccgacagactctgatgtgagtgctgggaacatcctccagctttttcatggcaag
agccggatccagcgtcttaacatcctcaacgccaagttcgctttcaacctctaccgagtg
ctgaaagaccaggtcaacactttcgataacatcttcatagcacccgttggcatttctact
gcgatgggtatgatttccttaggtctgaagggagagacccatgaacaagtgcactcgatt
ttgcattttaaagactttgttaatgccagcagcaagtatgaaatcacgaccattcataat
ctcttccgtaagctgactcatcgcctcttcaggaggaattttgggtacacactgcggtca
gtcaatgacctttatatccagaagcagtttccaatcctgcttgacttcaaaactaaagta
agagagtattactttgctgaggcccagatagctgacttctcagaccctgccttcatatca
aaaaccaacaaccacatcatgaagctcaccaagggcctcataaaagatgctctggagaat
atagaccctgctacccagatgatgattctcaactgcatctacttcaaaggatcctgggtg
aataaattcccagtggaaatgacacacaaccacaacttccggctgaatgagagagaggta
gttaaggtttccatgatgcagaccaaggggaacttcctcgcagcaaatgaccaggagctg
gactgcgacatcctccagctggaatacgtggggggcatcagcatgctaattgtggtccca
cacaagatgtctgggatgaagaccctcgaagcgcaactgacaccccgggtggtggagaga
tggcaaaaaagcatgacaaacagaactcgagaagtgcttctgccgaaattcaagctggag
aagaactacaatctagtggagtccctgaagttgatggggatcaggatgctgtttgacaaa
aatggcaacatggcaggcatctcagaccaaaggatcgccatcgacctgttcaagcaccaa
ggcacgatcacagtgaacgaggaaggcacccaagccaccactgtgaccacggtggggttc
atgccgctgtccacccaagtccgcttcactgtcgaccgcccctttcttttcctcatctac
gagcatcgcaccagctgcctgctcttcatgggaagagtggccaaccccagcaggtcctag

DBGET integrated database retrieval system