KEGG   Homo sapiens (human): 3055Help
Entry
3055              CDS       T01001                                 

Gene name
HCK, JTK9, p59Hck, p61Hck
Definition
(RefSeq) HCK proto-oncogene, Src family tyrosine kinase (EC:2.7.10.2)
  KO
K08893  
hemopoietic cell kinase [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
Chemokine signaling pathway
Fc gamma R-mediated phagocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    3055 (HCK)
   04062 Chemokine signaling pathway
    3055 (HCK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     3055 (HCK)
Protein kinases [BR:hsa01001]
 Tyrosine protein kinases
  Src family
   3055 (HCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20q11-q12
AA seq 526 aa AA seqDB search
MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIK
PGPNSHNSNTPGIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSL
ATRKEGYIPSNYVARVDSLETEEWFFKGISRKDAERQLLAPGNMLGSFMIRDSETTKGSY
SLSVRDYDPRQGDTVKHYKIRTLDNGGFYISPRSTFSTLQELVDHYKKGNDGLCQKLSVP
CMSSKPQKPWEKDAWEIPRESLKLEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVE
AFLAEANVMKTLQHDKLVKLHAVVTKEPIYIITEFMAKGSLLDFLKSDEGSKQPLPKLID
FSAQIAEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLARVIEDNEYTAREGAKFP
IKWTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALERGYRMPRPE
NCPEELYNIMMRCWKNRPEERPTFEYIQSVLDDFYTATESQYQQQP
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
ctgggggggcgctcaagctgcgaggatccgggctgcccgcgagacgaggagcgggcgccc
aggatggggtgcatgaagtccaagttcctccaggtcggaggcaatacattctcaaaaact
gaaaccagcgccagcccacactgtcctgtgtacgtgccggatcccacatccaccatcaag
ccggggcctaatagccacaacagcaacacaccaggaatcagggaggcaggctctgaggac
atcatcgtggttgccctgtatgattacgaggccattcaccacgaagacctcagcttccag
aagggggaccagatggtggtcctagaggaatccggggagtggtggaaggctcgatccctg
gccacccggaaggagggctacatcccaagcaactatgtcgcccgcgttgactctctggag
acagaggagtggtttttcaagggcatcagccggaaggacgcagagcgccaactgctggct
cccggcaacatgctgggctccttcatgatccgggatagcgagaccactaaaggaagctac
tctttgtccgtgcgagactacgaccctcggcagggagataccgtgaaacattacaagatc
cggaccctggacaacgggggcttctacatatccccccgaagcaccttcagcactctgcag
gagctggtggaccactacaagaaggggaacgacgggctctgccagaaactgtcggtgccc
tgcatgtcttccaagccccagaagccttgggagaaagatgcctgggagatccctcgggaa
tccctcaagctggagaagaaacttggagctgggcagtttggggaagtctggatggccacc
tacaacaagcacaccaaggtggcagtgaagacgatgaagccagggagcatgtcggtggag
gccttcctggcagaggccaacgtgatgaaaactctgcagcatgacaagctggtcaaactt
catgcggtggtcaccaaggagcccatctacatcatcacggagttcatggccaaaggaagc
ttgctggactttctgaaaagtgatgagggcagcaagcagccattgccaaaactcattgac
ttctcagcccagattgcagaaggcatggccttcatcgagcagaggaactacatccaccga
gacctccgagctgccaacatcttggtctctgcatccctggtgtgtaagattgctgacttt
ggcctggcccgggtcattgaggacaacgagtacacggctcgggaaggggccaagttcccc
atcaagtggacagctcctgaagccatcaactttggctccttcaccatcaagtcagacgtc
tggtcctttggtatcctgctgatggagatcgtcacctacggccggatcccttacccaggg
atgtcaaaccctgaagtgatccgagctctggagcgtggataccggatgcctcgcccagag
aactgcccagaggagctctacaacatcatgatgcgctgctggaaaaaccgtccggaggag
cggccgaccttcgaatacatccagagtgtgctggatgacttctacacggccacagagagc
cagtaccaacagcagccatga

DBGET integrated database retrieval system