KEGG   Homo sapiens (human): 3059Help
Entry
3059              CDS       T01001                                 

Gene name
HCLS1, CTTNL, HS1, lckBP1, p75
Definition
hematopoietic cell-specific Lyn substrate 1
Orthology
K06106  
cortactin
Organism
hsa  Homo sapiens (human)
Pathway
Tight junction
Bacterial invasion of epithelial cells
Pathogenic Escherichia coli infection
Shigellosis
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cellular commiunity
   04530 Tight junction
    3059 (HCLS1)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    3059 (HCLS1)
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    3059 (HCLS1)
   05131 Shigellosis
    3059 (HCLS1)
   05100 Bacterial invasion of epithelial cells
    3059 (HCLS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q13
AA seq 449 aa AA seqDB search
MWKSVVGHDVSVSVETQGDDWDTDPDFVNDISEKEQRWGAKTIEGSGRTEHINIHQLRNK
VSEEHDVLRKKEMESGPKASHGYGGRFGVERDRMDKSAVGHEYVAEVEKHSSQTDAAKGF
GGKYGVERDRADKSAVGFDYKGEVEKHTSQKDYAKGFGGQYGIQKDRVDKSAVGFNEMEA
PTTAYKKTTPIEAASSGTRGLKAKFESMAEEKRKREEEEKAQQVARRQQERKAVTKRSPE
APQPVIAMEEPAVPAPLPKKISSEAWPPVGTPPSSESEPVRTSREHPVPLLPIRQTLPED
NEEPPALPPRTLEGLQVEEEPVYEAEPEPEPEPEPEPENDYEDVEEMDRHEQEDEPEGDY
EEVLEPEDSSFSSALAGSSGCPAGAGAGAVALGISAVALYDYQGEGSDELSFDPDDVITD
IEMVDEGWWRGRCHGHFGLFPANYVKLLE
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgtggaagtctgtagtgggccatgatgtgtctgtttccgtggagacccagggtgatgat
tgggacacagatcctgactttgtgaatgacatctctgaaaaggagcaacgatggggagcc
aagaccatcgaggggtctggacgcacagaacacatcaacatccaccagctgaggaacaaa
gtatcagaggagcatgatgttctcaggaagaaagagatggagtcagggcccaaagcatcc
catggctatggaggtcggtttggagtagaaagagaccgaatggacaagagtgcagtgggc
catgagtatgttgccgaggtggagaagcactcttctcagacggatgctgccaaaggcttt
gggggcaagtacggagttgagagggacagggcagacaagtcagcagtcggctttgattat
aaaggagaagtggagaagcacacatctcagaaagattatgccaagggctttggtggccag
tatggaatccagaaggaccgagtggataagagcgctgtcggcttcaatgaaatggaggcc
ccgaccacagcttataagaagacgacgcccatagaagccgcttctagtggtacccgtggg
ctgaaggcgaaatttgagtccatggctgaggagaagaggaagcgagaggaagaggagaag
gcacagcaggtggccaggaggcaacaggagcgaaaggctgtgacaaagaggagccctgag
gctccacagccagtgatagctatggaagagccagcagtaccggccccactgcccaagaaa
atctcctcagaggcctggcctccagttgggactcctccatcatcagagtctgagcctgtg
agaaccagcagggaacacccagtgcccttgctgcccattaggcagactctcccggaggac
aatgaggagcccccagctctgccccctaggactctggaaggcctccaggtggaggaagag
ccagtgtacgaagcagagcctgagcctgagcccgagcctgagcccgagcctgagaatgac
tatgaggacgttgaggagatggacaggcatgagcaggaggatgaaccagagggggactat
gaggaggtgctcgagcctgaagattcttctttttcttctgctctggctggatcatcaggc
tgcccggctggggctggggctggggctgtggctctggggatctcagctgtggctctatat
gattaccaaggagagggaagtgatgagctttcctttgatccggacgacgtaatcactgac
attgagatggtggacgagggctggtggcggggacgttgccatggccactttggactcttc
cctgcaaattatgtcaagcttctggagtga

DBGET integrated database retrieval system