KEGG   Homo sapiens (human): 306Help
Entry
306               CDS       T01001                                 

Gene name
ANXA3, ANX3
Definition
(RefSeq) annexin A3 (EC:3.1.4.43)
  KO
K17089  
annexin A3
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q21.21
AA seq 323 aa AA seqDB search
MASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSNAQRQLIVKEY
QAAYGKELKDDLKGDLSGHFEHLMVALVTPPAVFDAKQLKKSMKGAGTNEDALIEILTTR
TSRQMKDISQAYYTVYKKSLGDDISSETSGDFRKALLTLADGRRDESLKVDEHLAKQDAQ
ILYKAGENRWGTDEDKFTEILCLRSFPQLKLTFDEYRNISQKDIVDSIKGELSGHFEDLL
LAIVNCVRNTPAFLAERLHRALKGIGTDEFTLNRIMVSRSEIDLLDIRTEFKKHYGYSLY
SAIKSDTSGDYEITLLKICGGDD
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggcatctatctgggttggacaccgaggaacagtaagagattatccagactttagccca
tcagtggatgctgaagctattcagaaagcaatcagaggaattggaactgatgagaaaatg
ctcatcagcattctgactgagaggtcaaatgcacagcggcagctgattgttaaggaatat
caagcagcatatggaaaggagctgaaagatgacttgaagggtgatctctctggccacttt
gagcatctcatggtggccctagtgactccaccagcagtctttgatgcaaagcagctaaag
aaatccatgaagggcgcgggaacaaacgaagatgccttgattgaaatcttaactaccagg
acaagcaggcaaatgaaggatatctctcaagcctattatacagtatacaagaagagtctt
ggagatgacattagttccgaaacatctggtgacttccggaaagctctgttgactttggca
gatggcagaagagatgaaagtctgaaagtggatgagcatctggccaaacaagatgcccag
attctctataaagctggtgagaacagatggggcacggatgaagacaaattcactgagatc
ctgtgtttaaggagctttcctcaattaaaactaacatttgatgaatacagaaatatcagc
caaaaggacattgtggacagcataaaaggagaattatctgggcattttgaagacttactg
ttggccatagttaattgtgtgaggaacacgccggcctttttagccgaaagactgcatcga
gccttgaagggtattggaactgatgagtttactctgaaccgaataatggtgtccagatca
gaaattgaccttttggacattcgaacagagttcaagaagcattatggctattccctatat
tcagcaattaaatcggatacttctggagactatgaaatcacactcttaaaaatctgtggt
ggagatgactga

DBGET integrated database retrieval system