KEGG   Homo sapiens (human): 3061Help
Entry
3061              CDS       T01001                                 

Gene name
HCRTR1, OX1R
Definition
(RefSeq) hypocretin receptor 1
  KO
K04238  
hypocretin (orexin) receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Drug target
Almorexant: 
Filorexant: 
Suvorexant: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3061 (HCRTR1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Neuropeptide
   Orexin
    3061 (HCRTR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O43613(Tclin)
UniProt: 
Position
1p35.2
AA seq 425 aa AA seqDB search
MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFVVA
LVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCK
VIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAIMVPQA
AVMECSSVLPELANRTRLFSVCDERWADDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFR
KLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGEPQPRARAFLAEVKQMRARRKTAKML
MVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNF
LSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSV
TTVLP
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggagccctcagccaccccaggggcccagatgggggtcccccctggcagcagagagccg
tcccctgtgcctccagactatgaagatgagtttctccgctatctgtggcgcgattatctg
tacccaaaacagtatgagtgggtcctcatcgcagcctatgtggctgtgttcgtcgtggcc
ctggtgggcaacacgctggtctgcctggccgtgtggcggaaccaccacatgaggacagtc
accaactacttcattgtcaacctgtccctggctgacgttctggtgactgctatctgcctg
ccggccagcctgctggtggacatcactgagtcctggctgttcggccatgccctctgcaag
gtcatcccctatctacaggctgtgtccgtgtcagtggcagtgctaactctcagcttcatc
gccctggaccgctggtatgccatctgccacccactattgttcaagagcacagcccggcgg
gcccgtggctccatcctgggcatctgggctgtgtcgctggccatcatggtgccccaggct
gcagtcatggaatgcagcagtgtgctgcctgagctagccaaccgcacacggctcttctca
gtctgtgatgaacgctgggcagatgacctctatcccaagatctaccacagttgcttcttt
attgtcacctacctggccccactgggcctcatggccatggcctatttccagatattccgc
aagctctggggccgccagatccccggcaccacctcagcactggtgcggaactggaagcgc
ccctcagaccagctgggggacctggagcagggcctgagtggagagccccagccccgggcc
cgcgccttcctggctgaagtgaagcagatgcgtgcacggaggaagacagccaagatgctg
atggtggtgctgctggtcttcgccctctgctacctgcccatcagcgtcctcaatgtcctt
aagagggtgttcgggatgttccgccaagccagtgaccgcgaagctgtctacgcctgcttc
accttctcccactggctggtgtacgccaacagcgctgccaaccccatcatctacaacttc
ctcagtggcaaattccgggagcagtttaaggctgccttctcctgctgcctgcctggcctg
ggtccctgcggctctctgaaggcccctagtccccgctcctctgccagccacaagtccttg
tccttgcagagccgatgctccatctccaaaatctctgagcatgtggtgctcaccagcgtc
accacagtgctgccctga

DBGET integrated database retrieval system