KEGG   Homo sapiens (human): 3066Help
Entry
3066              CDS       T01001                                 

Gene name
HDAC2, HD2, RPD3, YAF1
Definition
histone deacetylase 2 (EC:3.5.1.98)
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Notch signaling pathway
Thyroid hormone signaling pathway
Huntington's disease
Alcoholism
Epstein-Barr virus infection
Pathways in cancer
Transcriptional misregulation in cancer
Viral carcinogenesis
Chronic myeloid leukemia
Drug target
Vorinostat: 
Romidepsin: 
Panobinostat: 
Valproic acid: 
Other: 
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:hsa04330]
Cellular Processes; Cell growth and death; Cell cycle [PATH:hsa04110]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:hsa04919]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:hsa05202]
Human Diseases; Cancers; Viral carcinogenesis [PATH:hsa05203]
Human Diseases; Cancers; Chronic myeloid leukemia [PATH:hsa05220]
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:hsa05016]
Human Diseases; Substance dependence; Alcoholism [PATH:hsa05034]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:hsa05169]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
6q21
AA seq 488 aa AA seqDB search
MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
TAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVA
GAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQ
IFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLG
GGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYM
EKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEE
FSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGT
KSEQLSNP
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggcgtacagtcaaggaggcggcaaaaaaaaagtctgctactactacgacggtgatatt
ggaaattattattatggacagggtcatcccatgaagcctcatagaatccgcatgacccat
aacttgctgttaaattatggcttatacagaaaaatggaaatatataggccccataaagcc
actgccgaagaaatgacaaaatatcacagtgatgagtatatcaaatttctacggtcaata
agaccagataacatgtctgagtatagtaagcagatgcagagatttaatgttggagaagat
tgtccagtgtttgatggactctttgagttttgtcagctctcaactggcggttcagttgct
ggagctgtgaagttaaaccgacaacagactgatatggctgttaattgggctggaggatta
catcatgctaagaaatcagaagcatcaggattctgttacgttaatgatattgtgcttgcc
atccttgaattactaaagtatcatcagagagtcttatatattgatatagatattcatcat
ggtgatggtgttgaagaagctttttatacaacagatcgtgtaatgacggtatcattccat
aaatatggggaatactttcctggcacaggagacttgagggatattggtgctggaaaaggc
aaatactatgctgtcaattttccaatgagagatggtatagatgatgagtcatatgggcag
atatttaagcctattatctcaaaggtgatggagatgtatcaacctagtgctgtggtatta
cagtgtggtgcagactcattatctggtgatagactgggttgtttcaatctaacagtcaaa
ggtcatgctaaatgtgtagaagttgtaaaaacttttaacttaccattactgatgcttgga
ggaggtggctacacaatccgtaatgttgctcgatgttggacatatgagactgcagttgcc
cttgattgtgagattcccaatgagttgccatataatgattactttgagtattttggacca
gacttcaaactgcatattagtccttcaaacatgacaaaccagaacactccagaatatatg
gaaaagataaaacagcgtttgtttgaaaatttgcgcatgttacctcatgcacctggtgtc
cagatgcaagctattccagaagatgctgttcatgaagacagtggagatgaagatggagaa
gatccagacaagagaatttctattcgagcatcagacaagcggatagcttgtgatgaagaa
ttctcagattctgaggatgaaggagaaggaggtcgaagaaatgtggctgatcataagaaa
ggagcaaagaaagctagaattgaagaagataagaaagaaacagaggacaaaaaaacagac
gttaaggaagaagataaatccaaggacaacagtggtgaaaaaacagataccaaaggaacc
aaatcagaacagctcagcaacccctga

DBGET integrated database retrieval system