KEGG   Homo sapiens (human): 3067Help
Entry
3067              CDS       T01001                                 

Gene name
HDC
Definition
(RefSeq) histidine decarboxylase (EC:4.1.1.22)
  KO
K01590  
histidine decarboxylase [EC:4.1.1.22]
Organism
hsa  Homo sapiens (human)
Pathway
Histidine metabolism
Metabolic pathways
Disease
H00862  
Tourette syndrome
Drug target
Brocresine: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    3067 (HDC)
Enzymes [BR:hsa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.22  histidine decarboxylase
     3067 (HDC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
15q21.2
AA seq 662 aa AA seqDB search
MMEPEEYRERGREMVDYICQYLSTVRERRVTPDVQPGYLRAQLPESAPEDPDSWDSIFGD
IERIIMPGVVHWQSPHMHAYYPALTSWPSLLGDMLADAINCLGFTWASSPACTELEMNVM
DWLAKMLGLPEHFLHHHPSSQGGGVLQSTVSESTLIALLAARKNKILEMKTSEPDADESC
LNARLVAYASDQAHSSVEKAGLISLVKMKFLPVDDNFSLRGEALQKAIEEDKQRGLVPVF
VCATLGTTGVCAFDCLSELGPICAREGLWLHIDAAYAGTAFLCPEFRGFLKGIEYADSFT
FNPSKWMMVHFDCTGFWVKDKYKLQQTFSVNPIYLRHANSGVATDFMHWQIPLSRRFRSV
KLWFVIRSFGVKNLQAHVRHGTEMAKYFESLVRNDPSFEIPAKRHLGLVVFRLKGPNCLT
ENVLKEIAKAGRLFLIPATIQDKLIIRFTVTSQFTTRDDILRDWNLIRDAATLILSQHCT
SQPSPRVGNLISQIRGARAWACGTSLQSVSGAGDDPVQARKIIKQPQRVGAGPMKRENGL
HLETLLDPVDDCFSEEAPDATKHKLSSFLFSYLSVQTKKKTVRSLSCNSVPVSAQKPLPT
EASVKNGGSSRVRIFSRFPEDMMMLKKSAFKKLIKFYSVPSFPECSSQCGLQLPCCPLQA
MV
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgatggagcctgaggagtacagagagagagggagagagatggtggattacatctgccag
tacctgagcactgtgcgggagagacgtgtgacgccagacgtgcagcctggctacctgcga
gcccagctgcctgagagtgctcctgaggaccccgacagctgggacagcatctttggggac
attgaacgaatcatcatgcctggggtggtacattggcagagcccccatatgcacgcctac
tacccagccctcacctcttggccctccctgctaggagacatgctggctgatgccatcaac
tgcttgggattcacctgggcatccagccctgcgtgtacagagctggagatgaacgtcatg
gactggttggcaaaaatgctgggacttccagagcacttcttgcaccaccaccccagcagc
cagggcggaggcgtcctgcagagcacggtcagtgaatccactttgattgccctgctggca
gcaaggaagaacaaaatcctggaaatgaaaacgtctgagcccgatgctgatgagtcctgc
ctaaatgcccgactcgtggcctatgcctctgaccaggctcactcctctgtggaaaaggct
ggtttgatttcccttgtgaagatgaaatttctgcctgtggatgacaacttctcactccga
ggggaagctcttcagaaggccatcgaggaagacaagcagcggggcttggtgcccgtcttt
gtctgtgcaacactagggaccactggggtctgtgcatttgactgcctgtcagagctgggc
cccatctgtgcccgtgaggggctgtggctccacatcgatgctgcttatgcaggcactgcc
ttcctgtgccccgagttccgggggtttctgaaggggattgagtatgccgactccttcacc
tttaatccttccaagtggatgatggtgcattttgactgtactgggttctgggtcaaggac
aagtacaagctgcagcagaccttcagtgtgaatcccatctacctcaggcatgccaactca
ggcgtggccaccgacttcatgcactggcagatccccctgagccgacggtttcgctctgtt
aaactctggttcgtgattcggtccttcggggtgaagaatcttcaagcacatgtcagacat
ggtactgaaatggctaaatattttgaatctctggtcagaaacgacccttcctttgaaatt
cctgccaagaggcaccttggcctggtggtttttcgtctaaagggtcctaattgtctcaca
gaaaatgtgttaaaggaaatagctaaagctggccgtctcttcctcatcccggccactatc
caggacaagttaatcatccgtttcactgtgacatcccagtttaccactagggatgacatc
ctgagagactggaatctcattcgagatgctgccactctcatcctgagtcagcactgtact
tcccaacccagccctcgggttgggaacctcatctcccaaatcaggggtgccagagcctgg
gcctgtggaacgtcccttcagtctgtcagtggggcaggagatgatccagtccaggccagg
aagatcatcaagcagcctcagcgtgtgggagccggtcccatgaaaagggaaaatggcctc
catcttgaaaccctgctggacccagttgatgactgcttttcagaagaggccccagatgcc
accaagcacaagctgtcctccttcctgttcagttacttgtctgtgcagactaagaagaag
acggtgcgctccctcagttgcaacagtgtgccagtgagtgctcagaagccactgcccaca
gaggcctctgtgaagaatgggggctcctccagggtcagaatcttttccaggtttccagaa
gacatgatgatgctgaagaaaagtgccttcaaaaaactcatcaaattctacagcgtcccc
agctttcctgaatgcagctctcaatgtggactccagctgccctgttgccctctgcaggcc
atggtttag

DBGET integrated database retrieval system