KEGG   Homo sapiens (human): 307Help
Entry
307               CDS       T01001                                 

Gene name
ANXA4, ANX4, HEL-S-274, P32.5, PAP-II, PIG28, PP4-X, ZAP36
Definition
(RefSeq) annexin A4
  KO
K17093  annexin A4
Organism
hsa  Homo sapiens (human)
Brite
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    307 (ANXA4)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    307 (ANXA4)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   307 (ANXA4)
  Exosomal proteins of other body fluids (saliva and urine)
   307 (ANXA4)
  Exosomal proteins of colorectal cancer cells
   307 (ANXA4)
  Exosomal proteins of bladder cancer cells
   307 (ANXA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Annexin FmdE
Motif
Other DBs
NCBI-GeneID: 307
NCBI-ProteinID: NP_001144
OMIM: 106491
HGNC: 542
Ensembl: ENSG00000196975
Vega: OTTHUMG00000129649
Pharos: P09525(Tbio)
UniProt: P09525 Q6P452 Q6LES2
Structure
PDB: 

Jmol
Position
2p13.3
AA seq 321 aa AA seqDB search
MAMATKGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKS
TIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTP
EEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDL
YEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLA
IVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSF
IKGDTSGDYRKVLLVLCGGDD
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggccatggcaaccaaaggaggtactgtcaaagctgcttcaggattcaatgccatggaa
gatgcccagaccctgaggaaggccatgaaagggctcggcaccgatgaagacgccattatt
agcgtccttgcctaccgcaacaccgcccagcgccaggagatcaggacagcctacaagagc
accatcggcagggacttgatagacgacctgaagtcagaactgagtggcaacttcgagcag
gtgattgtggggatgatgacgcccacggtgctgtatgacgtgcaagagctgcgaagggcc
atgaagggagccggcactgatgagggctgcctaattgagatcctggcctcccggacccct
gaggagatccggcgcataagccaaacctaccagcagcaatatggacggagccttgaagat
gacattcgctctgacacatcgttcatgttccagcgagtgctggtgtctctgtcagctggt
gggagggatgaaggaaattatctggacgatgctctcgtgagacaggatgcccaggacctg
tatgaggctggagagaagaaatgggggacagatgaggtgaaatttctaactgttctctgt
tcccggaaccgaaatcacctgttgcatgtgtttgatgaatacaaaaggatatcacagaag
gatattgaacagagtattaaatctgaaacatctggtagctttgaagatgctctgctggct
atagtaaagtgcatgaggaacaaatctgcatattttgctgaaaagctctataaatcgatg
aagggcttgggcaccgatgataacaccctcatcagagtgatggtttctcgagcagaaatt
gacatgttggatatccgggcacacttcaagagactctatggaaagtctctgtactcgttc
atcaagggtgacacatctggagactacaggaaagtactgcttgttctctgtggaggagat
gattaa

DBGET integrated database retrieval system