KEGG   Homo sapiens (human): 307Help
Entry
307               CDS       T01001                                 

Gene name
ANXA4, ANX4, HEL-S-274, P32.5, PAP-II, PIG28, PP4-X, ZAP36
Definition
(RefSeq) annexin A4
  KO
K17093  
annexin A4
Organism
hsa  Homo sapiens (human)
Brite
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   307 (ANXA4)
  Exosomal proteins of other body fluids (saliva and urine)
   307 (ANXA4)
  Exosomal proteins of colorectal cancer cells
   307 (ANXA4)
  Exosomal proteins of bladder cancer cells
   307 (ANXA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
2p13
AA seq 321 aa AA seqDB search
MAMATKGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKS
TIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTP
EEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDL
YEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLA
IVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSF
IKGDTSGDYRKVLLVLCGGDD
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggccatggcaaccaaaggaggtactgtcaaagctgcttcaggattcaatgccatggaa
gatgcccagaccctgaggaaggccatgaaagggctcggcaccgatgaagacgccattatt
agcgtccttgcctaccgcaacaccgcccagcgccaggagatcaggacagcctacaagagc
accatcggcagggacttgatagacgacctgaagtcagaactgagtggcaacttcgagcag
gtgattgtggggatgatgacgcccacggtgctgtatgacgtgcaagagctgcgaagggcc
atgaagggagccggcactgatgagggctgcctaattgagatcctggcctcccggacccct
gaggagatccggcgcataagccaaacctaccagcagcaatatggacggagccttgaagat
gacattcgctctgacacatcgttcatgttccagcgagtgctggtgtctctgtcagctggt
gggagggatgaaggaaattatctggacgatgctctcgtgagacaggatgcccaggacctg
tatgaggctggagagaagaaatgggggacagatgaggtgaaatttctaactgttctctgt
tcccggaaccgaaatcacctgttgcatgtgtttgatgaatacaaaaggatatcacagaag
gatattgaacagagtattaaatctgaaacatctggtagctttgaagatgctctgctggct
atagtaaagtgcatgaggaacaaatctgcatattttgctgaaaagctctataaatcgatg
aagggcttgggcaccgatgataacaccctcatcagagtgatggtttctcgagcagaaatt
gacatgttggatatccgggcacacttcaagagactctatggaaagtctctgtactcgttc
atcaagggtgacacatctggagactacaggaaagtactgcttgttctctgtggaggagat
gattaa

DBGET integrated database retrieval system