KEGG   Homo sapiens (human): 3070Help
Entry
3070              CDS       T01001                                 

Gene name
HELLS, ICF4, LSH, Nbla10143, PASG, SMARCA6
Definition
(RefSeq) helicase, lymphoid-specific
  KO
K19001  
ATP-dependent DNA helicase
Organism
hsa  Homo sapiens (human)
Brite
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Chromatin remodeling factors
   Other chromatin remodeling factors
    3070 (HELLS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10q24.2
AA seq 838 aa AA seqDB search
MPAERPAGSGGSEAPAMVEQLDTAVITPAMLEEEEQLEAAGLERERKMLEKARMSWDRES
TEIRYRRLQHLLEKSNIYSKFLLTKMEQQQLEEQKKKEKLERKKESLKVKKGKNSIDASE
EKPVMRKKRGREDESYNISEVMSKEEILSVAKKNKKENEDENSSSTNLCVEDLQKNKDSN
SIIKDRLSETVRQNTKFFFDPVRKCNGQPVPFQQPKHFTGGVMRWYQVEGMEWLRMLWEN
GINGILADEMGLGKTVQCIATIALMIQRGVPGPFLVCGPLSTLPNWMAEFKRFTPDIPTM
LYHGTQEERQKLVRNIYKRKGTLQIHPVVITSFEIAMRDRNALQHCYWKYLIVDEGHRIK
NMKCRLIRELKRFNADNKLLLTGTPLQNNLSELWSLLNFLLPDVFDDLKSFESWFDITSL
SETAEDIIAKEREQNVLHMLHQILTPFLLRRLKSDVALEVPPKREVVVYAPLSKKQEIFY
TAIVNRTIANMFGSSEKETIELSPTGRPKRRTRKSINYSKIDDFPNELEKLISQIQPEVD
RERAVVEVNIPVESEVNLKLQNIMMLLRKCCNHPYLIEYPIDPVTQEFKIDEELVTNSGK
FLILDRMLPELKKRGHKVLLFSQMTSMLDILMDYCHLRDFNFSRLDGSMSYSEREKNMHS
FNTDPEVFIFLVSTRAGGLGINLTAADTVIIYDSDWNPQSDLQAQDRCHRIGQTKPVVVY
RLVTANTIDQKIVERAAAKRKLEKLIIHKNHFKGGQSGLNLSKNFLDPKELMELLKSRDY
EREIKGSREKVISDKDLELLLDRSDLIDQMNASGPIKEKMGIFKILENSEDSSPECLF
NT seq 2517 nt NT seq  +upstreamnt  +downstreamnt
atgccagcggaacggcccgcgggcagcggcggctcggaggctccagcaatggttgaacaa
ctggacactgctgtgattaccccggccatgctagaagaggaagaacagcttgaagctgct
ggactagagagagagcggaagatgctggaaaaggctcgcatgtcttgggatagagagtcg
acagaaattcggtaccgtagacttcaacatttgcttgaaaaaagcaatatatactccaaa
tttttattgacgaaaatggaacagcaacaattagaggaacagaagaagaaagaaaaattg
gagagaaaaaaggagtctttaaaagttaaaaagggtaaaaattcaattgatgcaagtgaa
gagaagccagttatgaggaaaaaaagaggaagagaagatgaatcatacaatatttcagag
gtcatgtcaaaagaggaaattttgtctgtggctaaaaaaaataaaaaggagaatgaggat
gaaaactcctcctctactaatctctgtgtggaagatcttcagaaaaataaagattcgaat
agtataattaaagatagattgtctgaaacggttaggcagaatactaaattcttttttgac
ccagtccggaagtgtaatggtcagccagtaccttttcaacaaccaaagcacttcactgga
ggagtgatgcgatggtaccaagtagaaggcatggaatggcttaggatgctttgggaaaat
ggaattaatggcattttagcagatgaaatgggattgggtaagacagttcagtgcattgct
actattgcattgatgattcagagaggagtaccaggaccttttcttgtctgtggccctttg
tctacacttcctaactggatggctgaattcaaaagatttacaccagatatccctacaatg
ttatatcatggaacccaggaggaacgtcaaaaattggtaagaaatatttacaaacggaaa
gggactttgcagattcatcctgtggtaatcacgtcatttgaaatagccatgagagaccga
aatgcgttacagcattgctattggaaatacttaatagtagatgaaggacacaggattaag
aatatgaagtgccgtctaatcagggagttaaaacgattcaatgctgataacaaacttctt
ttgactggtactcccttgcaaaacaatttatcagaactttggtcattgctaaactttttg
ttgccagatgtatttgatgacttgaaaagctttgagtcttggtttgacatcactagtctt
tctgaaactgctgaagatattattgctaaagaaagagaacagaatgtattgcatatgctg
caccagattttaacacctttcttattgagaagactgaagtctgatgttgctcttgaagtt
cctcctaaacgagaagtagtcgtttatgctccactttcaaagaagcaggagatcttttat
acagccattgtgaaccgtacaattgcaaacatgtttggatccagtgagaaagaaacaatt
gagttaagtcctactggtcgaccaaaacgacgaactagaaaatcaataaattacagcaaa
atagatgatttccctaatgaattggaaaaactgatcagtcaaatacagccagaggtggac
cgagaaagagctgttgtggaagtgaatatccctgtagaatctgaagttaatctgaagctg
cagaatataatgatgctacttcgtaaatgttgtaatcatccatatttgattgaatatcct
atagaccctgttacacaagaatttaagatcgatgaagaattggtaacaaattctgggaag
ttcttgattttggatcgaatgctgccagaactaaaaaaaagaggtcacaaggtgctgctt
ttttcacaaatgacaagcatgttggacattttgatggattactgccatctcagagatttc
aacttcagcaggcttgatgggtccatgtcttactcagagagagaaaaaaacatgcacagc
ttcaacacggatccagaggtgtttatcttcttagtgagtacacgagctggtggcctgggc
attaatctgactgcagcagatacagttatcatttatgatagtgattggaacccccagtcg
gatcttcaggcccaggatagatgtcatagaattggtcagacaaagccagttgttgtttat
cgccttgttacagcaaatactatcgatcagaaaattgtggaaagagcagctgctaaaagg
aaactggaaaagttgatcatccataaaaatcatttcaaaggtggtcagtctggattaaat
ctgtctaagaatttcttagatcctaaggaattaatggaattattaaaatctagagattat
gaaagggaaataaaaggatcaagagagaaggtcattagtgataaagatctagagttgttg
ttagatcgaagtgatcttattgatcaaatgaatgcttcaggaccaattaaagagaagatg
gggatattcaagatattagaaaattctgaagattccagtcctgaatgtttgttttaa

DBGET integrated database retrieval system