KEGG   Homo sapiens (human): 3071Help
Entry
3071              CDS       T01001                                 

Gene name
NCKAP1L, HEM1
Definition
(RefSeq) NCK associated protein 1 like
  KO
K05750  
NCK-associated protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    3071 (NCKAP1L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q13.1
AA seq 1127 aa AA seqDB search
MSLTSAYQHKLAEKLTILNDRGQGVLIRMYNIKKTCSDPKSKPPFLLEKSMEPSLKYINK
KFPNIDVRNSTQHLGPVHREKAEIIRFLTNYYQSFVDVMEFRDHVYELLNTIDACQCHFD
INLNFDFTRSYLDLIVTYTSVILLLSRIEDRRILIGMYNCAHEMLHGHGDPSFARLGQMV
LEYDHPLKKLTEEFGPHTKAVSGALLSLHFLFVRRNQGAEQWRSAQLLSLISNPPAMINP
ANSDTMACEYLSVEVMERWIIIGFLLCHGCLNSNSQCQKLWKLCLQGSLYITLIREDVLQ
VHKVTEDLFSSLKGYGKRVADIKESKEHVIANSGQFHCQRRQFLRMAVKELETVLADEPG
LLGPKALFAFMALSFIRDEVTWLVRHTENVTKTKTPEDYADSSIAELLFLLEGIRSLVRR
HIKVIQQYHLQYLARFDALVLSDIIQNLSVCPEEESIIMSSFVSILSSLNLKQVDNGEKF
EFSGLRLDWFRLQAYTSVAKAPLHLHENPDLAKVMNLIVFHSRMLDSVEKLLVETSDLST
FCFHLRIFEKMFAMTLEESAMLRYAIAFPLICAHFVHCTHEMCPEEYPHLKNHGLHHCNS
FLEELAKQTSNCVLEICAEQRNLSEQLLPKHCATTISKAKNKKTRKQRQTPRKGEPERDK
PGAESHRKNRSIVTNMDKLHLNLTELALTMNHVYSFSVFEHTIFPSEYLSSHLEARLNRA
IVWLAGYNATTQEIVRPSELLAGVKAYIGFIQSLAQFLGADASRVIRNALLQQTQPLDSC
GEQTITTLYTNWYLESLLRQASSGTIILSPAMQAFVSLPREGEQNFSAEEFSDISEMRAL
AELLGPYGMKFLSENLMWHVTSQIVELKKLVVENMDILVQIRSNFSKPDLMASLLPQLTG
AENVLKRMTIIGVILSFRAMAQEGLREVFSSHCPFLMGPIECLKEFVTPDTDIKVTLSIF
ELASAAGVGCDIDPALVAAIANLKADTSSPEEEYKVACLLLIFLAVSLPLLATDPSSFYS
IEKDGYNNNIHCLTKAIIQVSAALFTLYNKNIETHLKEFLVVASVSLLQLGQETDKLKTR
NRESISLLMRLVVEESSFLTLDMLESCFPYVLLRNAYREVSRAFHLN
NT seq 3384 nt NT seq  +upstreamnt  +downstreamnt
atgtctttgacatctgcttaccagcataaattagcagagaagctcactatcctgaatgat
cgcggtcagggggttctcatccgtatgtataacatcaagaagacttgttcagaccccaaa
tctaagccacctttcttactggaaaagtccatggaaccatctctcaagtatatcaacaag
aaatttcccaacatagatgtccgaaacagcacgcaacatttaggaccagtacatcgtgaa
aaagccgagataattagattcctcaccaactactaccagtcatttgtggatgtcatggaa
tttcgggatcatgtatatgaacttctcaacaccattgatgcctgccagtgccattttgat
atcaatctcaactttgatttcactcggagttacctggacttgattgtaacttacacctca
gtcattttacttctgtcacggattgaagatcggcggatactcattggcatgtacaattgt
gcccatgagatgctgcatgggcatggtgaccccagttttgcccgtctgggtcagatggtc
ttggagtatgaccaccctctgaagaagctgacagaagagtttgggcctcacacaaaggct
gtgagtggagccctcctctctttgcatttcctctttgtccgaagaaaccagggggctgag
cagtggcgcagtgcccaacttctaagcctcatcagcaaccccccagccatgattaaccct
gctaattcagatacaatggcctgtgagtatctgtctgtggaagtaatggagcgctggatt
atcattgggtttcttctttgtcatgggtgcctcaactccaatagccagtgccagaagctg
tggaagctgtgtctgcagggctccctctacatcacccttatccgtgaggatgtgctgcag
gtgcacaaagtcaccgaggacctgtttagcagtttgaaagggtatggcaagagagtggca
gacataaaggagagcaaggaacatgtaattgcaaacagtggccagtttcattgtcaacgg
cggcaatttctgcggatggcagtgaaggagctggagactgtgttggctgatgaaccggga
ctactgggtcctaaggctctttttgctttcatggccctgtccttcattcgtgatgaggtc
acctggctggttcgccacacagagaatgtcaccaagacaaagacacctgaggactatgct
gactcgagcattgcagagctacttttcttgttggaggggattaggtctctggtccgaaga
cacatcaaagtgatacagcaataccaccttcagtacttggcaagatttgatgctcttgtg
ctcagtgacatcattcagaacttgtctgtgtgtccagaggaggagtccatcatcatgtcc
tcattcgtcagtatcctctcctctctgaatctcaaacaagttgataatggagaaaaattt
gaattctcaggattgaggctggactggttccgcctacaggcatacactagcgtggctaag
gcccctctgcacctgcatgagaaccctgacttagccaaggtgatgaacctcattgtcttc
cactcccgaatgctggactccgtagaaaaattgctggtggaaacttctgatctgtctact
ttctgctttcatcttcgtatctttgagaagatgtttgccatgaccttggaggaatctgcc
atgttgcgttatgccattgctttccccctgatttgtgctcactttgtccactgcactcat
gagatgtgcccagaggagtacccccacctcaagaaccatggtcttcaccactgcaactcc
ttcctggaagagttggccaagcagaccagcaattgcgtcctggagatctgtgctgagcag
cgaaacctgagcgagcagcttctacctaagcactgtgccactacaatcagcaaagccaag
aacaagaaaaccaggaagcagaggcagactcccagaaaaggagagcccgagagggacaag
ccaggagctgagagtcaccggaagaaccgcagcattgtcaccaacatggacaagctacac
ctaaacttgacagaactggcactgacaatgaatcatgtatacagtttctccgtgtttgaa
catactatcttcccttctgagtacctcagcagccacctggaggccagactcaacagagcc
attgtgtggctggctggctacaatgccacgacccaggagatcgtacggccttctgagctg
ttggcaggagtcaaagcatacattggtttcatacagtcactggcccagtttttgggtgca
gatgcttccagagtcatccgcaacgccctcctgcagcagacacaaccactggattcctgt
ggggaacagacaatcaccacactctacacaaactggtacctggaaagtctgcttagacag
gcaagcagtgggaccatcatcctctccccagccatgcaggccttcgtcagcctgcccaga
gaaggggagcagaacttcagtgcagaggagttctctgacatctctgagatgcgggccttg
gcagaactcctgggcccctatggcatgaagttcctgagtgaaaacctgatgtggcatgtg
acctctcagattgtggagctgaagaagctggtggtggaaaacatggacatacttgttcag
atcagatccaactttagcaagccggacttgatggcttccctgctgccccagctgacaggg
gctgaaaatgtgctaaagcgcatgaccatcattggggttatcctcagtttcagggccatg
gcccaagagggacttcgggaggttttctcctcccactgcccatttcttatgggtcccatt
gagtgcttgaaggagtttgtcactccagacacagacatcaaggtgaccttgagtatcttt
gagctggcatctgctgcaggtgtgggctgtgacattgacccagccttggtggctgccatt
gctaatctgaaagctgatacttcatctcctgaggaggaatataaggtggcctgcctgctc
ttgatctttctggcagtttccctcccactccttgccactgacccttcttccttttatagc
attgagaaggatggttacaacaacaatattcattgcttgaccaaagccatcatccaggtg
tctgctgccctcttcacgctctacaacaagaacattgaaactcacctcaaggaatttctg
gtggtggcctctgtcagcctcttgcagctgggccaggagactgacaagcttaaaaccaga
aatcgagaatccatttctctgctcatgcgcttggtggtggaggagtcatccttcctgacc
ctggacatgctggagtcctgtttcccttatgtcctgcttcgaaatgcctatcgggaggtg
tctcgggccttccacctaaactga

DBGET integrated database retrieval system