KEGG   Homo sapiens (human): 3074Help
Entry
3074              CDS       T01001                                 

Gene name
HEXB, ENC-1AS, HEL-248
Definition
hexosaminidase B (beta polypeptide) (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
hsa  Homo sapiens (human)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Module
Keratan sulfate degradation
Disease
H00124  
GM2 gangliosidoses
H00426  
Defects in the degradation of ganglioside
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:hsa00520]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:hsa00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:hsa00603]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:hsa00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:hsa00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:hsa04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q13
AA seq 556 aa AA seqDB search
MELCGLGLPRPPMLLALLLATLLAAMLALLTQVALVVQVAEAARAPSVSAKPGPALWPLP
LSVKMTPNLLHLAPENFYISHSPNSTAGPSCTLLEEAFRRYHGYIFGFYKWHHEPAEFQA
KTQVQQLLVSITLQSECDAFPNISSDESYTLLVKEPVAVLKANRVWGALRGLETFSQLVY
QDSYGTFTINESTIIDSPRFSHRGILIDTSRHYLPVKIILKTLDAMAFNKFNVLHWHIVD
DQSFPYQSITFPELSNKGSYSLSHVYTPNDVRMVIEYARLRGIRVLPEFDTPGHTLSWGK
GQKDLLTPCYSRQNKLDSFGPINPTLNTTYSFLTTFFKEISEVFPDQFIHLGGDEVEFKC
WESNPKIQDFMRQKGFGTDFKKLESFYIQKVLDIIATINKGSIVWQEVFDDKAKLAPGTI
VEVWKDSAYPEELSRVTASGFPVILSAPWYLDLISYGQDWRKYYKVEPLDFGGTQKQKQL
FIGGEACLWGEYVDATNLTPRLWPRASAVGERLWSSKDVRDMDDAYDRLTRHRCRMVERG
IAAQPLYAGYCNHENM
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atggagctgtgcgggctggggctgccccggccgcccatgctgctggcgctgctgttggcg
acactgctggcggcgatgttggcgctgctgactcaggtggcgctggtggtgcaggtggcg
gaggcggctcgggccccgagcgtctcggccaagccggggccggcgctgtggcccctgccg
ctctcggtgaagatgaccccgaacctgctgcatctcgccccggagaacttctacatcagc
cacagccccaattccacggcgggcccctcctgcaccctgctggaggaagcgtttcgacga
tatcatggctatatttttggtttctacaagtggcatcatgaacctgctgaattccaggct
aaaacccaggttcagcaacttcttgtctcaatcacccttcagtcagagtgtgatgctttc
cccaacatatcttcagatgagtcttatactttacttgtgaaagaaccagtggctgtcctt
aaggccaacagagtttggggagcattacgaggtttagagacctttagccagttagtttat
caagattcttatggaactttcaccatcaatgaatccaccattattgattctccaaggttt
tctcacagaggaattttgattgatacatccagacattatctgccagttaagattattctt
aaaactctggatgccatggcttttaataagtttaatgttcttcactggcacatagttgat
gaccagtctttcccatatcagagcatcacttttcctgagttaagcaataaaggaagctat
tctttgtctcatgtttatacaccaaatgatgtccgtatggtgattgaatatgccagatta
cgaggaattcgagtcctgccagaatttgatacccctgggcatacactatcttggggaaaa
ggtcagaaagacctcctgactccatgttacagtagacaaaacaagttggactcttttgga
cctataaaccctactctgaatacaacatacagcttccttactacatttttcaaagaaatt
agtgaggtgtttccagatcaattcattcatttgggaggagatgaagtggaatttaaatgt
tgggaatcaaatccaaaaattcaagatttcatgaggcaaaaaggctttggcacagatttt
aagaaactagaatctttctacattcaaaaggttttggatattattgcaaccataaacaag
ggatccattgtctggcaggaggtttttgatgataaagcaaagcttgcgccgggcacaata
gttgaagtatggaaagacagcgcatatcctgaggaactcagtagagtcacagcatctggc
ttccctgtaatcctttctgctccttggtacttagatttgattagctatggacaagattgg
aggaaatactataaagtggaacctcttgattttggcggtactcagaaacagaaacaactt
ttcattggtggagaagcttgtctatggggagaatatgtggatgcaactaacctcactcca
agattatggcctcgggcaagtgctgttggtgagagactctggagttccaaagatgtcaga
gatatggatgacgcctatgacagactgacaaggcaccgctgcaggatggtcgaacgtgga
atagctgcacaacctctttatgctggatattgtaaccatgagaacatgtaa

DBGET integrated database retrieval system