KEGG   Homo sapiens (human): 308Help
Entry
308               CDS       T01001                                 

Gene name
ANXA5, ANX5, ENX2, HEL-S-7, PP4, RPRGL3
Definition
(RefSeq) annexin A5
  KO
K16646  
annexin A5
Organism
hsa  Homo sapiens (human)
Brite
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   308 (ANXA5)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Others
   308 (ANXA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q27
AA seq 320 aa AA seqDB search
MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTL
FGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPE
ELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALF
QAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAV
VKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMI
KGDTSGDYKKALLLLCGEDD
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggcacaggttctcagaggcactgtgactgacttccctggatttgatgagcgggctgat
gcagaaactcttcggaaggctatgaaaggcttgggcacagatgaggagagcatcctgact
ctgttgacatcccgaagtaatgctcagcgccaggaaatctctgcagcttttaagactctg
tttggcagggatcttctggatgacctgaaatcagaactaactggaaaatttgaaaaatta
attgtggctctgatgaaaccctctcggctttatgatgcttatgaactgaaacatgccttg
aagggagctggaacaaatgaaaaagtactgacagaaattattgcttcaaggacacctgaa
gaactgagagccatcaaacaagtttatgaagaagaatatggctcaagcctggaagatgac
gtggtgggggacacttcagggtactaccagcggatgttggtggttctccttcaggctaac
agagaccctgatgctggaattgatgaagctcaagttgaacaagatgctcaggctttattt
caggctggagaacttaaatgggggacagatgaagaaaagtttatcaccatctttggaaca
cgaagtgtgtctcatttgagaaaggtgtttgacaagtacatgactatatcaggatttcaa
attgaggaaaccattgaccgcgagacttctggcaatttagagcaactactccttgctgtt
gtgaaatctattcgaagtatacctgcctaccttgcagagaccctctattatgctatgaag
ggagctgggacagatgatcataccctcatcagagtcatggtttccaggagtgagattgat
ctgtttaacatcaggaaggagtttaggaagaattttgccacctctctttattccatgatt
aagggagatacatctggggactataagaaagctcttctgctgctctgtggagaagatgac
taa

DBGET integrated database retrieval system