KEGG   Homo sapiens (human): 3081Help
Entry
3081              CDS       T01001                                 

Gene name
HGD, AKU, HGO
Definition
homogentisate 1,2-dioxygenase (EC:1.13.11.5)
Orthology
K00451  
homogentisate 1,2-dioxygenase [EC:1.13.11.5]
Organism
hsa  Homo sapiens (human)
Pathway
Tyrosine metabolism
Metabolic pathways
Module
Tyrosine degradation, tyrosine => homogentisate
Disease
H00163  
Alkaptonuria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    3081 (HGD)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.5  homogentisate 1,2-dioxygenase
     3081 (HGD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q13.33
AA seq 445 aa AA seqDB search
MAELKYISGFGNECSSEDPRCPGSLPEGQNNPQVCPYNLYAEQLSGSAFTCPRSTNKRSW
LYRILPSVSHKPFESIDEGQVTHNWDEVDPDPNQLRWKPFEIPKASQKKVDFVSGLHTLC
GAGDIKSNNGLAIHIFLCNTSMENRCFYNSDGDFLIVPQKGNLLIYTEFGKMLVQPNEIC
VIQRGMRFSIDVFEETRGYILEVYGVHFELPDLGPIGANGLANPRDFLIPIAWYEDRQVP
GGYTVINKYQGKLFAAKQDVSPFNVVAWHGNYTPYKYNLKNFMVINSVAFDHADPSIFTV
LTAKSVRPGVAIADFVIFPPRWGVADKTFRPPYYHRNCMSEFMGLIRGHYEAKQGGFLPG
GGSLHSTMTPHGPDADCFEKASKVKLAPERIADGTMAFMFESSLSLAVTKWGLKASRCLD
ENYHKCWEPLKSHFTPNSRNPAEPN
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggctgagttaaagtacatttctggatttgggaatgagtgttcttcagaggatcctcgc
tgcccaggttccctgccagaaggacagaataatcctcaggtctgcccctacaatctctat
gctgagcagctctcaggatcggctttcacttgtccacggagcaccaataagagaagctgg
ctgtataggattctaccttcagtttctcacaagccctttgaatccattgacgaaggccaa
gtcactcacaactgggatgaagttgatcctgatcctaaccagcttagatggaaaccattt
gagattccaaaagcatctcagaagaaagtagactttgtgagtggcctgcataccttgtgt
ggagctggagacataaagtctaacaatgggcttgctatccacattttcctctgcaatacc
tccatggagaacagatgcttttacaattcagatggggacttcttgattgttccgcagaaa
gggaaccttctcatttacaccgagtttggcaagatgcttgtacagcccaatgagatctgc
gtcattcagagaggaatgcggttcagcatagatgtctttgaggagaccaggggctacatc
ttggaggtctatggtgtccactttgagttacctgaccttggaccaattggggccaatggc
ttggccaatcctcgtgatttcttgatacccattgcctggtatgaggatcgccaagtacca
ggtggttacacggtcattaataaataccagggcaagctgtttgctgccaaacaggatgtc
tccccgttcaatgttgtggcctggcacgggaattatacaccctacaagtacaacctgaag
aatttcatggttatcaactcagtggcctttgaccatgcagacccatccattttcacagta
ttgactgctaagtctgtccgccctggagtggccattgctgattttgtcatcttcccacct
cgatggggggttgctgataagaccttcaggcctccttattaccataggaactgcatgagt
gagttcatgggactcatccgaggtcactatgaggcaaagcaaggtgggttcctgccaggg
ggagggagtctacacagcacaatgaccccccatggacctgatgctgactgctttgagaag
gccagcaaggtcaagctggcacctgagaggattgccgatggcaccatggcatttatgttt
gaatcatctttaagtctggcggtcacaaagtggggactcaaggcctccaggtgtttggat
gagaactaccacaagtgctgggagccactcaagagccacttcactcccaactccaggaac
ccagcagaacctaattga

DBGET integrated database retrieval system