KEGG   Homo sapiens (human): 30833Help
Entry
30833             CDS       T01001                                 

Gene name
NT5C, DNT, DNT1, HEL74, P5N2, PN-I, PN-II, UMPH2, cdN, dNT-1
Definition
5', 3'-nucleotidase, cytosolic (EC:3.1.3.5)
Orthology
K01081  
5'-nucleotidase [EC:3.1.3.5]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Pyrimidine metabolism
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    30833 (NT5C)
   00240 Pyrimidine metabolism
    30833 (NT5C)
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    30833 (NT5C)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     30833 (NT5C)
Cellular antigens [BR:hsa04090]
 Proteins
  30833 (NT5C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q25.1
AA seq 161 aa AA seqDB search
MARSVRVLVDMDGVLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADK
VASVYEAPGFFLDLEPIPGALDAVREMNDLPDTQVFICTSPLLKYHHCVGEKEETPSWEH
ILFTCCHNRHLVLPPTRRRLLSWSDNWREILDSKRGAAQRE
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggcgcggagcgtgcgcgtgctggtggacatggacggcgtcctggccgacttcgaggcc
ggcctcctgcggggcttccgccgccgcttccctgaggagccgcacgtgccgctggagcaa
cgccgcggcttcctggcccgcgagcagtaccgcgccctgcggcccgacctggcggataaa
gtggccagtgtgtacgaagccccgggctttttcctggacctggagcccatcccgggagcc
ttggacgctgtgcgggagatgaacgacctaccggacacgcaggtcttcatctgcaccagc
cccctgctgaagtaccaccactgtgtgggtgagaaggaggagaccccaagctgggagcac
atcttgttcacctgctgccacaatcggcacctggtcctgcccccgacaaggagacggctg
ctctcctggagtgacaactggagggagatcttagatagcaagcgcggagctgcgcagcgg
gaatga

DBGET integrated database retrieval system