KEGG   Homo sapiens (human): 30833Help
Entry
30833             CDS       T01001                                 

Gene name
NT5C, DNT, DNT1, HEL74, P5N2, PN-I, PN-II, UMPH2, cdN, dNT-1
Definition
5', 3'-nucleotidase, cytosolic (EC:3.1.3.5)
Orthology
K01081  
5'-nucleotidase [EC:3.1.3.5]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Pyrimidine metabolism
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:hsa00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:hsa00240]
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:hsa00760]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q25.1
AA seq 161 aa AA seqDB search
MARSVRVLVDMDGVLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADK
VASVYEAPGFFLDLEPIPGALDAVREMNDLPDTQVFICTSPLLKYHHCVGEKEETPSWEH
ILFTCCHNRHLVLPPTRRRLLSWSDNWREILDSKRGAAQRE
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggcgcggagcgtgcgcgtgctggtggacatggacggcgtcctggccgacttcgaggcc
ggcctcctgcggggcttccgccgccgcttccctgaggagccgcacgtgccgctggagcaa
cgccgcggcttcctggcccgcgagcagtaccgcgccctgcggcccgacctggcggataaa
gtggccagtgtgtacgaagccccgggctttttcctggacctggagcccatcccgggagcc
ttggacgctgtgcgggagatgaacgacctaccggacacgcaggtcttcatctgcaccagc
cccctgctgaagtaccaccactgtgtgggtgagaaggaggagaccccaagctgggagcac
atcttgttcacctgctgccacaatcggcacctggtcctgcccccgacaaggagacggctg
ctctcctggagtgacaactggagggagatcttagatagcaagcgcggagctgcgcagcgg
gaatga

DBGET integrated database retrieval system