KEGG   Homo sapiens (human): 30837Help
Entry
30837             CDS       T01001                                 

Gene name
SOCS7, NAP4, NCKAP4
Definition
suppressor of cytokine signaling 7
Orthology
K04699  
suppressor of cytokine signaling 7
Organism
hsa  Homo sapiens (human)
Pathway
Jak-STAT signaling pathway
Prolactin signaling pathway
Module
ECS complex
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:hsa04630]
Organismal Systems; Endocrine system; Prolactin signaling pathway [PATH:hsa04917]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
17q12
AA seq 581 aa AA seqDB search
MVFRNVGRPPEEEDVEAAPEPGPSELLCPRHRCALDPKALPPGLALERTWGPAAGLEAQL
AALGLGQPAGPGVKTVGGGCCPCPCPPQPPPPQPQPPAAAPQAGEDPTETSDALLVLEGL
ESEAESLETNSCSEEELSSPGRGGGGGGRLLLQPPGPELPPVPFPLQDLVPLGRLSRGEQ
QQQQQQQPPPPPPPPGPLRPLAGPSRKGSFKIRLSRLFRTKSCNGGSGGGDGTGKRPSGE
LAASAASLTDMGGSAGRELDAGRKPKLTRTQSAFSPVSFSPLFTGETVSLVDVDISQRGL
TSPHPPTPPPPPRRSLSLLDDISGTLPTSVLVAPMGSSLQSFPLPPPPPPHAPDAFPRIA
PIRAAESLHSQPPQHLQCPLYRPDSSSFAASLRELEKCGWYWGPMNWEDAEMKLKGKPDG
SFLVRDSSDPRYILSLSFRSQGITHHTRMEHYRGTFSLWCHPKFEDRCQSVVEFIKRAIM
HSKNGKFLYFLRSRVPGLPPTPVQLLYPVSRFSNVKSLQHLCRFRIRQLVRIDHIPDLPL
PKPLISYIRKFYYYDPQEEVYLSLKEAQLISKQKQEVEPST
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atggtgttccgcaacgtgggtcggccgccggaggaggaggacgtggaggcggccccggag
ccgggaccctcggaactgctgtgtccccggcaccgctgtgccctggaccccaaggccctg
ccgccgggcttggcgctcgagcggacctggggcccggcggctggactagaggcgcagttg
gcggctctggggctcgggcagccggcggggccgggggtcaagacagtcggtgggggttgc
tgcccgtgtccgtgtcctcctcagccgccccctccgcagccccagccgcctgctgccgcc
ccgcaggccggggaggaccccacggaaacgagcgacgcgctgctggtcctggagggcttg
gaatcggaggccgagagcctggagactaacagctgctcggaagaggagctcagcagcccg
ggtcgcggaggaggagggggcggccggcttctgctgcagcccccaggccctgaattacct
ccggtgcccttcccgctgcaggacttggtccctctggggcgcctgagtagaggggagcag
cagcagcagcagcagcagcaacctcccccgcccccgcctcctcccgggcccctccggcca
ctcgcgggtccttctcggaagggctccttcaaaatccgcctcagtcgcctctttcgcacc
aagagctgcaacggtggctccggcggtggggatgggaccggcaagaggccttctggagag
ctggctgcttcagctgcgagcctgacagacatgggaggctctgcgggccgggagctggac
gcggggaggaaacccaagttgacaagaactcaaagtgccttttctccggtctccttcagc
cccctgttcacaggtgaaactgtgtcgcttgtggatgtggacatttctcagcggggcctg
acctctccacaccctccaactccccctcctcctccgagaagaagcctcagcctcctagat
gatatcagtgggacgctgcctacatctgtccttgtggctccgatggggtcttccttgcag
tctttccccctacctccgcctcctccaccccatgccccagatgcatttccccggattgct
cccatccgagcagctgaatccctgcacagccaacccccacagcacctccagtgtcccctc
taccggcctgactcgagcagctttgcagccagccttcgagagttggagaagtgtggttgg
tattgggggccaatgaattgggaagatgcagagatgaagctgaaagggaaaccagatggt
tctttcctggtacgagacagttctgatcctcgttacatcctgagcctcagtttccgatca
cagggtatcacccaccacactagaatggagcactacagaggaaccttcagcctgtggtgt
catcccaagtttgaggaccgctgtcaatctgttgtagagtttattaagagagccattatg
cactccaagaatggaaagtttctctatttcttaagatccagggttccaggactgccacca
actcctgtccagctgctctatccagtgtcccgattcagcaatgtcaaatccctccagcac
ctttgcagattccggatacgacagctcgtcaggatagatcacatcccagatctcccactg
cctaaacctctgatctcttatatccgaaagttctactactatgatcctcaggaagaggta
tacctgtctctaaaggaagcgcagctcatttccaaacagaagcaagaggtggaaccctcc
acgtag

DBGET integrated database retrieval system