KEGG   Homo sapiens (human): 3084Help
Entry
3084              CDS       T01001                                 

Gene name
NRG1, ARIA, GGF, GGF2, HGL, HRG, HRG1, HRGA, MST131, MSTP131, NDF, NRG1-IT2, SMDF
Definition
(RefSeq) neuregulin 1
  KO
K05455  
neuregulin 1
Organism
hsa  Homo sapiens (human)
Pathway
EGFR tyrosine kinase inhibitor resistance
ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    3084 (NRG1)
 Human Diseases
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    3084 (NRG1)
Cytokines [BR:hsa04052]
 PDGF family
  Other growth factors
   3084 (NRG1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
   3084 (NRG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8p12
AA seq 640 aa AA seqDB search
MSERKEGRGKGKGKKKERGSGKKPESAAGSQSPALPPRLKEMKSQESAAGSKLVLRCETS
SEYSSLRFKWFKNGNELNRKNKPQNIKIQKKPGKSELRINKASLADSGEYMCKVISKLGN
DSASANITIVESNEIITGMPASTEGAYVSSESPIRISVSTEGANTSSSTSTSTTGTSHLV
KCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCQPGFTGARCTENVPMKVQNQEKAEELYQ
KRVLTITGICIALLVVGIMCVVAYCKTKKQRKKLHDRLRQSLRSERNNMMNIANGPHHPN
PPPENVQLVNQYVSKNVISSEHIVEREAETSFSTSHYTSTAHHSTTVTQTPSHSWSNGHT
ESILSESHSVIVMSSVENSRHSSPTGGPRGRLNGTGGPRECNSFLRHARETPDSYRDSPH
SERYVSAMTTPARMSPVDFHTPSSPKSPPSEMSPPVSSMTVSMPSMAVSPFMEEERPLLL
VTPPRLREKKFDHHPQQFSSFHHNPAHDSNSLPASPLRIVEDEEYETTQEYEPAQEPVKK
LANSRRAKRTKPNGHIANRLEVDSNTSSQSSNSESETEDERVGEDTPFLGIQNPLAASLE
ATPAFRLADSRTNPAGRFSTQEEIQARLSSVIANQDPIAV
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagcgcaaagaaggcagaggcaaagggaagggcaagaagaaggagcgaggctcc
ggcaagaagccggagtccgcggcgggcagccagagcccagccttgcctccccgattgaaa
gagatgaaaagccaggaatcggctgcaggttccaaactagtccttcggtgtgaaaccagt
tctgaatactcctctctcagattcaagtggttcaagaatgggaatgaattgaatcgaaaa
aacaaaccacaaaatatcaagatacaaaaaaagccagggaagtcagaacttcgcattaac
aaagcatcactggctgattctggagagtatatgtgcaaagtgatcagcaaattaggaaat
gacagtgcctctgccaatatcaccatcgtggaatcaaacgagatcatcactggtatgcca
gcctcaactgaaggagcatatgtgtcttcagagtctcccattagaatatcagtatccaca
gaaggagcaaatacttcttcatctacatctacatccaccactgggacaagccatcttgta
aaatgtgcggagaaggagaaaactttctgtgtgaatggaggggagtgcttcatggtgaaa
gacctttcaaacccctcgagatacttgtgcaagtgccaacctggattcactggagcaaga
tgtactgagaatgtgcccatgaaagtccaaaaccaagaaaaggcggaggagctgtaccag
aagagagtgctgaccataaccggcatctgcatcgccctccttgtggtcggcatcatgtgt
gtggtggcctactgcaaaaccaagaaacagcggaaaaagctgcatgaccgtcttcggcag
agccttcggtctgaacgaaacaatatgatgaacattgccaatgggcctcaccatcctaac
ccaccccccgagaatgtccagctggtgaatcaatacgtatctaaaaacgtcatctccagt
gagcatattgttgagagagaagcagagacatccttttccaccagtcactatacttccaca
gcccatcactccactactgtcacccagactcctagccacagctggagcaacggacacact
gaaagcatcctttccgaaagccactctgtaatcgtgatgtcatccgtagaaaacagtagg
cacagcagcccaactgggggcccaagaggacgtcttaatggcacaggaggccctcgtgaa
tgtaacagcttcctcaggcatgccagagaaacccctgattcctaccgagactctcctcat
agtgaaaggtatgtgtcagccatgaccaccccggctcgtatgtcacctgtagatttccac
acgccaagctcccccaaatcgcccccttcggaaatgtctccacccgtgtccagcatgacg
gtgtccatgccttccatggcggtcagccccttcatggaagaagagagacctctacttctc
gtgacaccaccaaggctgcgggagaagaagtttgaccatcaccctcagcagttcagctcc
ttccaccacaaccccgcgcatgacagtaacagcctccctgctagccccttgaggatagtg
gaggatgaggagtatgaaacgacccaagagtacgagccagcccaagagcctgttaagaaa
ctcgccaatagccggcgggccaaaagaaccaagcccaatggccacattgctaacagattg
gaagtggacagcaacacaagctcccagagcagtaactcagagagtgaaacagaagatgaa
agagtaggtgaagatacgcctttcctgggcatacagaaccccctggcagccagtcttgag
gcaacacctgccttccgcctggctgacagcaggactaacccagcaggccgcttctcgaca
caggaagaaatccaggccaggctgtctagtgtaattgctaaccaagaccctattgctgta
taa

DBGET integrated database retrieval system