KEGG   Homo sapiens (human): 3087Help
Entry
3087              CDS       T01001                                 

Gene name
HHEX, HEX, HMPH, HOX11L-PEN, PRH, PRHX
Definition
(RefSeq) hematopoietically expressed homeobox
  KO
K08024  
homeobox protein HEX
Organism
hsa  Homo sapiens (human)
Pathway
Maturity onset diabetes of the young
Transcriptional misregulation in cancer
Network
N00121  
LMO2-rearrangement to transcriptional activation
Disease
H00409  
Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    3087 (HHEX)
  Endocrine and metabolic diseases
   04950 Maturity onset diabetes of the young
    3087 (HHEX)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, not assigned
    3087 (HHEX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q03014(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
10q23.33
AA seq 270 aa AA seqDB search
MQYPHPGPAAGAVGVPLYAPTPLLQPAHPTPFYIEDILGRGPAAPTPAPTLPSPNSSFTS
LVSPYRTPVYEPTPIHPAFSHHSAAALAAAYGPGGFGGPLYPFPRTVNDYTHALLRHDPL
GKPLLWSPFLQRPLHKRKGGQVRFSNDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQ
VKTWFQNRRAKWRRLKQENPQSNKKEELESLDSSCDQRQDLPSEQNKGASLDSSQCSPSP
ASQEDLESEISEDSDQEVDIEGDKSYFNAG
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgcagtacccgcaccccgggccggcggcgggcgccgtgggggtgccgctgtacgcgccc
acgccgctgctgcaacccgcacacccgacgcccttttacatcgaggacatcctgggccgc
gggcccgccgcgcccacgcccgcccccacgctgccgtcccccaactcctccttcaccagc
ctcgtgtccccctaccggaccccggtgtacgagcccacgccgatccatccagccttctcg
caccactccgccgccgcgctggccgctgcctacggacccggcggcttcgggggccctctg
taccccttcccgcggacggtgaacgactacacgcacgccctgctccgccacgaccccctg
ggcaaacctctactctggagccccttcttgcagaggcctctgcataaaaggaaaggcggc
caggtgagattctccaacgaccagaccatcgagctggagaagaaattcgagacgcagaaa
tatctctctccgcccgagaggaagcgtctggccaagatgctgcagctcagcgagagacag
gtcaaaacctggtttcagaatcgacgcgctaaatggaggagactaaaacaggagaaccct
caaagcaataaaaaagaagaactggaaagtttggacagttcctgtgatcagaggcaagat
ttgcccagtgaacagaataaaggtgcttctttggatagctctcaatgttcgccctcccct
gcctcccaggaagaccttgaatcagagatttcagaggattctgatcaggaagtggacatt
gagggcgataaaagctattttaatgctggatga

DBGET integrated database retrieval system