KEGG   Homo sapiens (human): 3087Help
Entry
3087              CDS       T01001                                 

Gene name
HHEX, HEX, HMPH, HOX11L-PEN, PRH, PRHX
Definition
(RefSeq) hematopoietically expressed homeobox
  KO
K08024  
homeobox protein HEX
Organism
hsa  Homo sapiens (human)
Pathway
Maturity onset diabetes of the young
Transcriptional misregulation in cancer
Disease
H00409  
Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    3087 (HHEX)
  Endocrine and metabolic diseases
   04950 Maturity onset diabetes of the young
    3087 (HHEX)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, not assigned
    3087 (HHEX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q03014(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
10q23.33
AA seq 270 aa AA seqDB search
MQYPHPGPAAGAVGVPLYAPTPLLQPAHPTPFYIEDILGRGPAAPTPAPTLPSPNSSFTS
LVSPYRTPVYEPTPIHPAFSHHSAAALAAAYGPGGFGGPLYPFPRTVNDYTHALLRHDPL
GKPLLWSPFLQRPLHKRKGGQVRFSNDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQ
VKTWFQNRRAKWRRLKQENPQSNKKEELESLDSSCDQRQDLPSEQNKGASLDSSQCSPSP
ASQEDLESEISEDSDQEVDIEGDKSYFNAG
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgcagtacccgcaccccgggccggcggcgggcgccgtgggggtgccgctgtacgcgccc
acgccgctgctgcaacccgcacacccgacgcccttttacatcgaggacatcctgggccgc
gggcccgccgcgcccacgcccgcccccacgctgccgtcccccaactcctccttcaccagc
ctcgtgtccccctaccggaccccggtgtacgagcccacgccgatccatccagccttctcg
caccactccgccgccgcgctggccgctgcctacggacccggcggcttcgggggccctctg
taccccttcccgcggacggtgaacgactacacgcacgccctgctccgccacgaccccctg
ggcaaacctctactctggagccccttcttgcagaggcctctgcataaaaggaaaggcggc
caggtgagattctccaacgaccagaccatcgagctggagaagaaattcgagacgcagaaa
tatctctctccgcccgagaggaagcgtctggccaagatgctgcagctcagcgagagacag
gtcaaaacctggtttcagaatcgacgcgctaaatggaggagactaaaacaggagaaccct
caaagcaataaaaaagaagaactggaaagtttggacagttcctgtgatcagaggcaagat
ttgcccagtgaacagaataaaggtgcttctttggatagctctcaatgttcgccctcccct
gcctcccaggaagaccttgaatcagagatttcagaggattctgatcaggaagtggacatt
gagggcgataaaagctattttaatgctggatga

DBGET integrated database retrieval system