KEGG   Homo sapiens (human): 309Help
Entry
309               CDS       T01001                                 

Gene name
ANXA6, ANX6, CBP68
Definition
(RefSeq) annexin A6
  KO
K17094  
annexin A6
Organism
hsa  Homo sapiens (human)
Brite
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   309 (ANXA6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q33.1
AA seq 673 aa AA seqDB search
MAKPAQGAKYRGSIHDFPGFDPNQDAEALYTAMKGFGSDKEAILDIITSRSNRQRQEVCQ
SYKSLYGKDLIADLKYELTGKFERLIVGLMRPPAYCDAKEIKDAISGIGTDEKCLIEILA
SRTNEQMHQLVAAYKDAYERDLEADIIGDTSGHFQKMLVVLLQGTREEDDVVSEDLVQQD
VQDLYEAGELKWGTDEAQFIYILGNRSKQHLRLVFDEYLKTTGKPIEASIRGELSGDFEK
LMLAVVKCIRSTPEYFAERLFKAMKGLGTRDNTLIRIMVSRSELDMLDIREIFRTKYEKS
LYSMIKNDTSGEYKKTLLKLSGGDDDAAGQFFPEAAQVAYQMWELSAVARVELKGTVRPA
NDFNPDADAKALRKAMKGLGTDEDTIIDIITHRSNVQRQQIRQTFKSHFGRDLMTDLKSE
ISGDLARLILGLMMPPAHYDAKQLKKAMEGAGTDEKALIEILATRTNAEIRAINEAYKED
YHKSLEDALSSDTSGHFRRILISLATGHREEGGENLDQAREDAQVAAEILEIADTPSGDK
TSLETRFMTILCTRSYPHLRRVFQEFIKMTNYDVEHTIKKEMSGDVRDAFVAIVQSVKNK
PLFFADKLYKSMKGAGTDEKTLTRIMVSRSEIDLLNIRREFIEKYDKSLHQAIEGDTSGD
FLKALLALCGGED
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atggccaaaccagcacagggtgccaagtaccggggctccatccatgacttcccaggcttt
gaccccaaccaggatgccgaggctctgtacactgccatgaagggctttggcagtgacaag
gaggccatactggacataatcacctcacggagcaacaggcagaggcaggaggtctgccag
agctacaagtccctctacggcaaggacctcattgctgatttaaagtatgaattgacgggc
aagtttgaacggttgattgtgggcctgatgaggccacctgcctattgtgatgccaaagaa
attaaagatgccatctcgggcattggcactgatgagaagtgcctcattgagatcttggct
tcccggaccaatgagcagatgcaccagctggtggcagcatacaaagatgcctacgagcgg
gacctggaggctgacatcatcggcgacacctctggccacttccagaagatgcttgtggtc
ctgctccagggaaccagggaggaggatgacgtagtgagcgaggacctggtacaacaggat
gtccaggacctatacgaggcaggggaactgaaatggggaacagatgaagcccagttcatt
tacatcttgggaaatcgcagcaagcagcatcttcggttggtgttcgatgagtatctgaag
accacagggaagccgattgaagccagcatccgaggggagctgtctggggactttgagaag
ctaatgctggccgtagtgaagtgtatccggagcaccccggaatattttgctgaaaggctc
ttcaaggctatgaagggcctggggactcgggacaacaccctgatccgcatcatggtctcc
cgtagtgagttggacatgctcgacattcgggagatcttccggaccaagtatgagaagtcc
ctctacagcatgatcaagaatgacacctctggcgagtacaagaagactctgctgaagctg
tctgggggagatgatgatgctgctggccagttcttcccggaggcagcgcaggtggcctat
cagatgtgggaacttagtgcagtggcccgagtagagctgaagggaactgtgcgcccagcc
aatgacttcaaccctgacgcagatgccaaagcgctgcggaaagccatgaagggactcggg
actgacgaagacacaatcatcgatatcatcacgcaccgcagcaatgtccagcggcagcag
atccggcagaccttcaagtctcactttggccgggacttaatgactgacctgaagtctgag
atctctggagacctggcaaggctgattctggggctcatgatgccaccggcccattacgat
gccaagcagttgaagaaggccatggagggagccggcacagatgaaaaggctcttattgaa
atcctggccactcggaccaatgctgaaatccgggccatcaatgaggcctataaggaggac
tatcacaagtccctggaggatgctctgagctcagacacatctggccacttcaggaggatc
ctcatttctctggccacggggcatcgtgaggagggaggagaaaacctggaccaggcacgg
gaagatgcccaggtggctgctgagatcttggaaatagcagacacacctagtggagacaaa
acttccttggagacacgtttcatgacgatcctgtgtacccggagctatccgcacctccgg
agagtcttccaggagttcatcaagatgaccaactatgacgtggagcacaccatcaagaag
gagatgtctggggatgtcagggatgcatttgtggccattgttcaaagtgtcaagaacaag
cctctcttctttgccgacaaactttacaaatccatgaagggtgctggcacagatgagaag
actctgaccaggatcatggtatcccgcagtgagattgacctgctcaacatccggagggaa
ttcattgagaaatatgacaagtctctccaccaagccattgagggtgacacctccggagac
ttcctgaaggccttgctggctctctgtggtggtgaggactag

DBGET integrated database retrieval system