KEGG   Homo sapiens (human): 3091Help
Entry
3091              CDS       T01001                                 

Gene name
HIF1A, HIF-1A, HIF-1alpha, HIF1, HIF1-ALPHA, MOP1, PASD8, bHLHe78
Definition
hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor)
Orthology
K08268  
hypoxia-inducible factor 1 alpha
Organism
hsa  Homo sapiens (human)
Pathway
HIF-1 signaling pathway
mTOR signaling pathway
Thyroid hormone signaling pathway
Pathways in cancer
Proteoglycans in cancer
Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    3091 (HIF1A)
   04150 mTOR signaling pathway
    3091 (HIF1A)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    3091 (HIF1A)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    3091 (HIF1A)
   05205 Proteoglycans in cancer
    3091 (HIF1A)
   05211 Renal cell carcinoma
    3091 (HIF1A)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    3091 (HIF1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q23.2
AA seq 850 aa AA seqDB search
MSSQCRSLENKFVFLKEGLGNSKPEELEEIRIENGRISSERRKEKSRDAARSRRSKESEV
FYELAHQLPLPHNVSSHLDKASVMRLTISYLRVRKLLDAGDLDIEDDMKAQMNCFYLKAL
DGFVMVLTDDGDMIYISDNVNKYMGLTQFELTGHSVFDFTHPCDHEEMREMLTHRNGLVK
KGKEQNTQRSFFLRMKCTLTSRGRTMNIKSATWKVLHCTGHIHVYDTNSNQPQCGYKKPP
MTCLVLICEPIPHPSNIEIPLDSKTFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIY
EYYHALDSDHLTKTHHDMFTKGQVTTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIV
CVNYVVSGIIQHDLIFSLQQTECVLKPVESSDMKMTQLFTKVESEDTSSLFDKLKKEPDA
LTLLAPAAGDTIISLDFGSNDTETDDQQLEEVPLYNDVMLPSPNEKLQNINLAMSPLPTA
ETPKPLRSSADPALNQEVALKLEPNPESLELSFTMPQIQDQTPSPSDGSTRQSSPEPNSP
SEYCFYVDSDMVNEFKLELVEKLFAEDTEAKNPFSTQDTDLDLEMLAPYIPMDDDFQLRS
FDQLSPLESSSASPESASPQSTVTVFQQTQIQEPTANATTTTATTDELKTVTKDRMEDIK
ILIASPSPTHIHKETTSATSSPYRDTQSRTASPNRAGKGVIEQTEKSHPRSPNVLSVALS
QRTTVPEEELNPKILALQNAQRKRKMEHDGSLFQAVGIGTLLQQPDDHAATTSLSWKRVK
GCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGE
ELLRALDQVN
NT seq 2553 nt NT seq  +upstreamnt  +downstreamnt
atgagctcccaatgtcggagtttggaaaacaaatttgtctttttaaaagaaggtctagga
aactcaaaacctgaagaattggaagaaatcagaatagaaaatggtaggataagttctgaa
cgtcgaaaagaaaagtctcgagatgcagccagatctcggcgaagtaaagaatctgaagtt
ttttatgagcttgctcatcagttgccacttccacataatgtgagttcgcatcttgataag
gcctctgtgatgaggcttaccatcagctatttgcgtgtgaggaaacttctggatgctggt
gatttggatattgaagatgacatgaaagcacagatgaattgcttttatttgaaagccttg
gatggttttgttatggttctcacagatgatggtgacatgatttacatttctgataatgtg
aacaaatacatgggattaactcagtttgaactaactggacacagtgtgtttgattttact
catccatgtgaccatgaggaaatgagagaaatgcttacacacagaaatggccttgtgaaa
aagggtaaagaacaaaacacacagcgaagcttttttctcagaatgaagtgtaccctaact
agccgaggaagaactatgaacataaagtctgcaacatggaaggtattgcactgcacaggc
cacattcacgtatatgataccaacagtaaccaacctcagtgtgggtataagaaaccacct
atgacctgcttggtgctgatttgtgaacccattcctcacccatcaaatattgaaattcct
ttagatagcaagactttcctcagtcgacacagcctggatatgaaattttcttattgtgat
gaaagaattaccgaattgatgggatatgagccagaagaacttttaggccgctcaatttat
gaatattatcatgctttggactctgatcatctgaccaaaactcatcatgatatgtttact
aaaggacaagtcaccacaggacagtacaggatgcttgccaaaagaggtggatatgtctgg
gttgaaactcaagcaactgtcatatataacaccaagaattctcaaccacagtgcattgta
tgtgtgaattacgttgtgagtggtattattcagcacgacttgattttctcccttcaacaa
acagaatgtgtccttaaaccggttgaatcttcagatatgaaaatgactcagctattcacc
aaagttgaatcagaagatacaagtagcctctttgacaaacttaagaaggaacctgatgct
ttaactttgctggccccagccgctggagacacaatcatatctttagattttggcagcaac
gacacagaaactgatgaccagcaacttgaggaagtaccattatataatgatgtaatgctc
ccctcacccaacgaaaaattacagaatataaatttggcaatgtctccattacccaccgct
gaaacgccaaagccacttcgaagtagtgctgaccctgcactcaatcaagaagttgcatta
aaattagaaccaaatccagagtcactggaactttcttttaccatgccccagattcaggat
cagacacctagtccttccgatggaagcactagacaaagttcacctgagcctaatagtccc
agtgaatattgtttttatgtggatagtgatatggtcaatgaattcaagttggaattggta
gaaaaactttttgctgaagacacagaagcaaagaacccattttctactcaggacacagat
ttagacttggagatgttagctccctatatcccaatggatgatgacttccagttacgttcc
ttcgatcagttgtcaccattagaaagcagttccgcaagccctgaaagcgcaagtcctcaa
agcacagttacagtattccagcagactcaaatacaagaacctactgctaatgccaccact
accactgccaccactgatgaattaaaaacagtgacaaaagaccgtatggaagacattaaa
atattgattgcatctccatctcctacccacatacataaagaaactactagtgccacatca
tcaccatatagagatactcaaagtcggacagcctcaccaaacagagcaggaaaaggagtc
atagaacagacagaaaaatctcatccaagaagccctaacgtgttatctgtcgctttgagt
caaagaactacagttcctgaggaagaactaaatccaaagatactagctttgcagaatgct
cagagaaagcgaaaaatggaacatgatggttcactttttcaagcagtaggaattggaaca
ttattacagcagccagacgatcatgcagctactacatcactttcttggaaacgtgtaaaa
ggatgcaaatctagtgaacagaatggaatggagcaaaagacaattattttaataccctct
gatttagcatgtagactgctggggcaatcaatggatgaaagtggattaccacagctgacc
agttatgattgtgaagttaatgctcctatacaaggcagcagaaacctactgcagggtgaa
gaattactcagagctttggatcaagttaactga

DBGET integrated database retrieval system