KEGG   Homo sapiens (human): 3091Help
Entry
3091              CDS       T01001                                 

Gene name
HIF1A, HIF-1A, HIF-1alpha, HIF1, HIF1-ALPHA, MOP1, PASD8, bHLHe78
Definition
hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor)
Orthology
K08268  
hypoxia-inducible factor 1 alpha
Organism
hsa  Homo sapiens (human)
Pathway
HIF-1 signaling pathway
mTOR signaling pathway
Thyroid hormone signaling pathway
Pathways in cancer
Proteoglycans in cancer
Renal cell carcinoma
Class
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:hsa04066]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:hsa04150]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:hsa04919]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:hsa05205]
Human Diseases; Cancers; Renal cell carcinoma [PATH:hsa05211]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q23.2
AA seq 850 aa AA seqDB search
MSSQCRSLENKFVFLKEGLGNSKPEELEEIRIENGRISSERRKEKSRDAARSRRSKESEV
FYELAHQLPLPHNVSSHLDKASVMRLTISYLRVRKLLDAGDLDIEDDMKAQMNCFYLKAL
DGFVMVLTDDGDMIYISDNVNKYMGLTQFELTGHSVFDFTHPCDHEEMREMLTHRNGLVK
KGKEQNTQRSFFLRMKCTLTSRGRTMNIKSATWKVLHCTGHIHVYDTNSNQPQCGYKKPP
MTCLVLICEPIPHPSNIEIPLDSKTFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIY
EYYHALDSDHLTKTHHDMFTKGQVTTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIV
CVNYVVSGIIQHDLIFSLQQTECVLKPVESSDMKMTQLFTKVESEDTSSLFDKLKKEPDA
LTLLAPAAGDTIISLDFGSNDTETDDQQLEEVPLYNDVMLPSPNEKLQNINLAMSPLPTA
ETPKPLRSSADPALNQEVALKLEPNPESLELSFTMPQIQDQTPSPSDGSTRQSSPEPNSP
SEYCFYVDSDMVNEFKLELVEKLFAEDTEAKNPFSTQDTDLDLEMLAPYIPMDDDFQLRS
FDQLSPLESSSASPESASPQSTVTVFQQTQIQEPTANATTTTATTDELKTVTKDRMEDIK
ILIASPSPTHIHKETTSATSSPYRDTQSRTASPNRAGKGVIEQTEKSHPRSPNVLSVALS
QRTTVPEEELNPKILALQNAQRKRKMEHDGSLFQAVGIGTLLQQPDDHAATTSLSWKRVK
GCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGE
ELLRALDQVN
NT seq 2553 nt NT seq  +upstreamnt  +downstreamnt
atgagctcccaatgtcggagtttggaaaacaaatttgtctttttaaaagaaggtctagga
aactcaaaacctgaagaattggaagaaatcagaatagaaaatggtaggataagttctgaa
cgtcgaaaagaaaagtctcgagatgcagccagatctcggcgaagtaaagaatctgaagtt
ttttatgagcttgctcatcagttgccacttccacataatgtgagttcgcatcttgataag
gcctctgtgatgaggcttaccatcagctatttgcgtgtgaggaaacttctggatgctggt
gatttggatattgaagatgacatgaaagcacagatgaattgcttttatttgaaagccttg
gatggttttgttatggttctcacagatgatggtgacatgatttacatttctgataatgtg
aacaaatacatgggattaactcagtttgaactaactggacacagtgtgtttgattttact
catccatgtgaccatgaggaaatgagagaaatgcttacacacagaaatggccttgtgaaa
aagggtaaagaacaaaacacacagcgaagcttttttctcagaatgaagtgtaccctaact
agccgaggaagaactatgaacataaagtctgcaacatggaaggtattgcactgcacaggc
cacattcacgtatatgataccaacagtaaccaacctcagtgtgggtataagaaaccacct
atgacctgcttggtgctgatttgtgaacccattcctcacccatcaaatattgaaattcct
ttagatagcaagactttcctcagtcgacacagcctggatatgaaattttcttattgtgat
gaaagaattaccgaattgatgggatatgagccagaagaacttttaggccgctcaatttat
gaatattatcatgctttggactctgatcatctgaccaaaactcatcatgatatgtttact
aaaggacaagtcaccacaggacagtacaggatgcttgccaaaagaggtggatatgtctgg
gttgaaactcaagcaactgtcatatataacaccaagaattctcaaccacagtgcattgta
tgtgtgaattacgttgtgagtggtattattcagcacgacttgattttctcccttcaacaa
acagaatgtgtccttaaaccggttgaatcttcagatatgaaaatgactcagctattcacc
aaagttgaatcagaagatacaagtagcctctttgacaaacttaagaaggaacctgatgct
ttaactttgctggccccagccgctggagacacaatcatatctttagattttggcagcaac
gacacagaaactgatgaccagcaacttgaggaagtaccattatataatgatgtaatgctc
ccctcacccaacgaaaaattacagaatataaatttggcaatgtctccattacccaccgct
gaaacgccaaagccacttcgaagtagtgctgaccctgcactcaatcaagaagttgcatta
aaattagaaccaaatccagagtcactggaactttcttttaccatgccccagattcaggat
cagacacctagtccttccgatggaagcactagacaaagttcacctgagcctaatagtccc
agtgaatattgtttttatgtggatagtgatatggtcaatgaattcaagttggaattggta
gaaaaactttttgctgaagacacagaagcaaagaacccattttctactcaggacacagat
ttagacttggagatgttagctccctatatcccaatggatgatgacttccagttacgttcc
ttcgatcagttgtcaccattagaaagcagttccgcaagccctgaaagcgcaagtcctcaa
agcacagttacagtattccagcagactcaaatacaagaacctactgctaatgccaccact
accactgccaccactgatgaattaaaaacagtgacaaaagaccgtatggaagacattaaa
atattgattgcatctccatctcctacccacatacataaagaaactactagtgccacatca
tcaccatatagagatactcaaagtcggacagcctcaccaaacagagcaggaaaaggagtc
atagaacagacagaaaaatctcatccaagaagccctaacgtgttatctgtcgctttgagt
caaagaactacagttcctgaggaagaactaaatccaaagatactagctttgcagaatgct
cagagaaagcgaaaaatggaacatgatggttcactttttcaagcagtaggaattggaaca
ttattacagcagccagacgatcatgcagctactacatcactttcttggaaacgtgtaaaa
ggatgcaaatctagtgaacagaatggaatggagcaaaagacaattattttaataccctct
gatttagcatgtagactgctggggcaatcaatggatgaaagtggattaccacagctgacc
agttatgattgtgaagttaatgctcctatacaaggcagcagaaacctactgcagggtgaa
gaattactcagagctttggatcaagttaactga

DBGET integrated database retrieval system