KEGG   Homo sapiens (human): 3091Help
Entry
3091              CDS       T01001                                 

Gene name
HIF1A, HIF-1-alpha, HIF-1A, HIF-1alpha, HIF1, HIF1-ALPHA, MOP1, PASD8, bHLHe78
Definition
(RefSeq) hypoxia inducible factor 1 alpha subunit
  KO
K08268  
hypoxia-inducible factor 1 alpha
Organism
hsa  Homo sapiens (human)
Pathway
HIF-1 signaling pathway
Mitophagy - animal
Autophagy - animal
Th17 cell differentiation
Thyroid hormone signaling pathway
Kaposi's sarcoma-associated herpesvirus infection
Pathways in cancer
Proteoglycans in cancer
Renal cell carcinoma
Central carbon metabolism in cancer
Choline metabolism in cancer
Network
N00079  
HIF-1 signaling pathway
N00080  
Loss of VHL to HIF-1 signaling pathway
N00081  
Mutation-inactivated VHL to HIF-1 signaling pathway
N00157  
KSHV vGPCR to GNB/G-ERK signaling pathway
Disease
H01509  
Tonsillar cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    3091 (HIF1A)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    3091 (HIF1A)
   04137 Mitophagy - animal
    3091 (HIF1A)
 Organismal Systems
  Immune system
   04659 Th17 cell differentiation
    3091 (HIF1A)
  Endocrine system
   04919 Thyroid hormone signaling pathway
    3091 (HIF1A)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    3091 (HIF1A)
   05230 Central carbon metabolism in cancer
    3091 (HIF1A)
   05231 Choline metabolism in cancer
    3091 (HIF1A)
   05205 Proteoglycans in cancer
    3091 (HIF1A)
   05211 Renal cell carcinoma
    3091 (HIF1A)
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    3091 (HIF1A)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    3091 (HIF1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q16665(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
14q23.2
AA seq 826 aa AA seqDB search
MEGAGGANDKKKISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVSSHLDKASVM
RLTISYLRVRKLLDAGDLDIEDDMKAQMNCFYLKALDGFVMVLTDDGDMIYISDNVNKYM
GLTQFELTGHSVFDFTHPCDHEEMREMLTHRNGLVKKGKEQNTQRSFFLRMKCTLTSRGR
TMNIKSATWKVLHCTGHIHVYDTNSNQPQCGYKKPPMTCLVLICEPIPHPSNIEIPLDSK
TFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIYEYYHALDSDHLTKTHHDMFTKGQV
TTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNYVVSGIIQHDLIFSLQQTECV
LKPVESSDMKMTQLFTKVESEDTSSLFDKLKKEPDALTLLAPAAGDTIISLDFGSNDTET
DDQQLEEVPLYNDVMLPSPNEKLQNINLAMSPLPTAETPKPLRSSADPALNQEVALKLEP
NPESLELSFTMPQIQDQTPSPSDGSTRQSSPEPNSPSEYCFYVDSDMVNEFKLELVEKLF
AEDTEAKNPFSTQDTDLDLEMLAPYIPMDDDFQLRSFDQLSPLESSSASPESASPQSTVT
VFQQTQIQEPTANATTTTATTDELKTVTKDRMEDIKILIASPSPTHIHKETTSATSSPYR
DTQSRTASPNRAGKGVIEQTEKSHPRSPNVLSVALSQRTTVPEEELNPKILALQNAQRKR
KMEHDGSLFQAVGIGTLLQQPDDHAATTSLSWKRVKGCKSSEQNGMEQKTIILIPSDLAC
RLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN
NT seq 2481 nt NT seq  +upstreamnt  +downstreamnt
atggagggcgccggcggcgcgaacgacaagaaaaagataagttctgaacgtcgaaaagaa
aagtctcgagatgcagccagatctcggcgaagtaaagaatctgaagttttttatgagctt
gctcatcagttgccacttccacataatgtgagttcgcatcttgataaggcctctgtgatg
aggcttaccatcagctatttgcgtgtgaggaaacttctggatgctggtgatttggatatt
gaagatgacatgaaagcacagatgaattgcttttatttgaaagccttggatggttttgtt
atggttctcacagatgatggtgacatgatttacatttctgataatgtgaacaaatacatg
ggattaactcagtttgaactaactggacacagtgtgtttgattttactcatccatgtgac
catgaggaaatgagagaaatgcttacacacagaaatggccttgtgaaaaagggtaaagaa
caaaacacacagcgaagcttttttctcagaatgaagtgtaccctaactagccgaggaaga
actatgaacataaagtctgcaacatggaaggtattgcactgcacaggccacattcacgta
tatgataccaacagtaaccaacctcagtgtgggtataagaaaccacctatgacctgcttg
gtgctgatttgtgaacccattcctcacccatcaaatattgaaattcctttagatagcaag
actttcctcagtcgacacagcctggatatgaaattttcttattgtgatgaaagaattacc
gaattgatgggatatgagccagaagaacttttaggccgctcaatttatgaatattatcat
gctttggactctgatcatctgaccaaaactcatcatgatatgtttactaaaggacaagtc
accacaggacagtacaggatgcttgccaaaagaggtggatatgtctgggttgaaactcaa
gcaactgtcatatataacaccaagaattctcaaccacagtgcattgtatgtgtgaattac
gttgtgagtggtattattcagcacgacttgattttctcccttcaacaaacagaatgtgtc
cttaaaccggttgaatcttcagatatgaaaatgactcagctattcaccaaagttgaatca
gaagatacaagtagcctctttgacaaacttaagaaggaacctgatgctttaactttgctg
gccccagccgctggagacacaatcatatctttagattttggcagcaacgacacagaaact
gatgaccagcaacttgaggaagtaccattatataatgatgtaatgctcccctcacccaac
gaaaaattacagaatataaatttggcaatgtctccattacccaccgctgaaacgccaaag
ccacttcgaagtagtgctgaccctgcactcaatcaagaagttgcattaaaattagaacca
aatccagagtcactggaactttcttttaccatgccccagattcaggatcagacacctagt
ccttccgatggaagcactagacaaagttcacctgagcctaatagtcccagtgaatattgt
ttttatgtggatagtgatatggtcaatgaattcaagttggaattggtagaaaaacttttt
gctgaagacacagaagcaaagaacccattttctactcaggacacagatttagacttggag
atgttagctccctatatcccaatggatgatgacttccagttacgttccttcgatcagttg
tcaccattagaaagcagttccgcaagccctgaaagcgcaagtcctcaaagcacagttaca
gtattccagcagactcaaatacaagaacctactgctaatgccaccactaccactgccacc
actgatgaattaaaaacagtgacaaaagaccgtatggaagacattaaaatattgattgca
tctccatctcctacccacatacataaagaaactactagtgccacatcatcaccatataga
gatactcaaagtcggacagcctcaccaaacagagcaggaaaaggagtcatagaacagaca
gaaaaatctcatccaagaagccctaacgtgttatctgtcgctttgagtcaaagaactaca
gttcctgaggaagaactaaatccaaagatactagctttgcagaatgctcagagaaagcga
aaaatggaacatgatggttcactttttcaagcagtaggaattggaacattattacagcag
ccagacgatcatgcagctactacatcactttcttggaaacgtgtaaaaggatgcaaatct
agtgaacagaatggaatggagcaaaagacaattattttaataccctctgatttagcatgt
agactgctggggcaatcaatggatgaaagtggattaccacagctgaccagttatgattgt
gaagttaatgctcctatacaaggcagcagaaacctactgcagggtgaagaattactcaga
gctttggatcaagttaactga

DBGET integrated database retrieval system