KEGG   Homo sapiens (human): 3099Help
Entry
3099              CDS       T01001                                 

Gene name
HK2, HKII, HXK2
Definition
hexokinase 2 (EC:2.7.1.1)
Orthology
K00844  
hexokinase [EC:2.7.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Butirosin and neomycin biosynthesis
Metabolic pathways
Carbon metabolism
HIF-1 signaling pathway
Insulin signaling pathway
Type II diabetes mellitus
Carbohydrate digestion and absorption
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    3099 (HK2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    3099 (HK2)
   00051 Fructose and mannose metabolism
    3099 (HK2)
   00052 Galactose metabolism
    3099 (HK2)
   00500 Starch and sucrose metabolism
    3099 (HK2)
   00520 Amino sugar and nucleotide sugar metabolism
    3099 (HK2)
  Biosynthesis of other secondary metabolites
   00524 Butirosin and neomycin biosynthesis
    3099 (HK2)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    3099 (HK2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    3099 (HK2)
  Digestive system
   04973 Carbohydrate digestion and absorption
    3099 (HK2)
 Human Diseases
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    3099 (HK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     3099 (HK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2p13
AA seq 917 aa AA seqDB search
MIASHLLAYFFTELNHDQVQKVDQYLYHMRLSDETLLEISKRFRKEMEKGLGATTHPTAA
VKMLPTFVRSTPDGTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMR
GSGTQLFDHIAECLANFMDKLQIKDKKLPLGFTFSFPCHQTKLDESFLVSWTKGFKSSGV
EGRDVVALIRKAIQRRGDFDIDIVAVVNDTVGTMMTCGYDDHNCEIGLIVGTGSNACYME
EMRHIDMVEGDEGRMCINMEWGAFGDDGSLNDIRTEFDQEIDMGSLNPGKQLFEKMISGM
YMGELVRLILVKMAKEELLFGGKLSPELLNTGRFETKDISDIEGEKDGIRKAREVLMRLG
LDPTQEDCVATHRICQIVSTRSASLCAATLAAVLQRIKENKGEERLRSTIGVDGSVYKKH
PHFAKRLHKTVRRLVPGCDVRFLRSEDGSGKGAAMVTAVAYRLADQHRARQKTLEHLQLS
HDQLLEVKRRMKVEMERGLSKETHASAPVKMLPTYVCATPDGTEKGDFLALDLGGTNFRV
LLVRVRNGKWGGVEMHNKIYAIPQEVMHGTGDELFDHIVQCIADFLEYMGMKGVSLPLGF
TFSFPCQQNSLDESILLKWTKGFKASGCEGEDVVTLLKEAIHRREEFDLDVVAVVNDTVG
TMMTCGFEDPHCEVGLIVGTGSNACYMEEMRNVELVEGEEGRMCVNMEWGAFGDNGCLDD
FRTEFDVAVDELSLNPGKQRFEKMISGMYLGEIVRNILIDFTKRGLLFRGRISERLKTRG
IFETKFLSQIESDCLALLQVRAILQHLGLESTCDDSIIVKEVCTVVARRAAQLCGAGMAA
VVDRIRENRGLDALKVTVGVDGTLYKLHPHFAKVMHETVKDLAPKCDVSFLQSEDGSGKG
AALITAVACRIREAGQR
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgattgcctcgcatctgcttgcctacttcttcacggagctcaaccatgaccaagtgcag
aaggttgaccagtatctctaccacatgcgcctctctgatgagaccctcttggagatctct
aagcggttccgcaaggagatggagaaagggcttggagccaccactcaccctactgcagca
gtgaagatgctgcccacctttgtgaggtccactccagatgggacagaacacggagagttc
ctggctctggatcttggagggaccaacttccgtgtgctttgggtgaaagtaacggacaat
gggctccagaaggtggagatggagaatcagatctatgccatccctgaggacatcatgcga
ggcagtggcacccagctgtttgaccacattgccgaatgcctggctaacttcatggataag
ctacaaatcaaagacaagaagctcccactgggttttaccttctcgttcccctgccaccag
actaaactagacgagagtttcctggtctcatggaccaagggattcaagtccagtggagtg
gaaggcagagacgttgtggctctgatccggaaggccatccagaggagaggggactttgat
atcgacattgtggctgtggtgaatgacacagttgggaccatgatgacctgtggttatgat
gaccacaactgtgagattggtctcattgtgggcacgggcagcaacgcctgctacatggaa
gagatgcgccacatcgacatggtggaaggcgatgaggggcggatgtgtatcaatatggag
tggggggccttcggggacgatggctcgctcaacgacattcgcactgagtttgaccaggag
attgacatgggctcactgaacccgggaaagcaactgtttgagaagatgatcagtgggatg
tacatgggggagctggtgaggcttatcctggtgaagatggccaaggaggagctgctcttt
ggggggaagctcagcccagagcttctcaacaccggtcgctttgagaccaaagacatctca
gacattgaaggggagaaggatggcatccggaaggcccgtgaggtcctgatgcggttgggc
ctggacccgactcaggaggactgcgtggccactcaccggatctgccagatcgtgtccaca
cgctccgccagcctgtgcgcagccaccctggccgccgtgctgcagcgcatcaaggagaac
aaaggcgaggagcggctgcgctctactattggggtcgacggttccgtctacaagaaacac
ccccattttgccaagcgtctacataagaccgtgcggcggctggtgcccggctgcgatgtc
cgcttcctccgctccgaggatggcagtggcaaaggtgcagccatggtgacagcagtggct
taccggctggccgatcaacaccgtgcccgccagaagacattagagcatctgcagctgagc
catgaccagctgctggaggtcaagaggaggatgaaggtagaaatggagcgaggtctgagc
aaggagactcatgccagtgcccccgtcaagatgctgcccacctacgtgtgtgctaccccg
gacggcacagagaaaggggacttcttggccttggaccttggaggaacaaatttccgggtc
ctgctggtccgtgttcggaatgggaagtggggtggagtggagatgcacaacaagatctac
gccatcccgcaggaggtcatgcacggcaccggggacgagctctttgaccacattgtccag
tgcatcgcggacttcctcgagtacatgggcatgaagggcgtgtccctgcctctgggtttt
accttctccttcccctgccagcagaacagcctggacgagagcatcctcctcaagtggaca
aaaggcttcaaggcatctggctgcgagggcgaggacgtggtgaccctgctgaaggaagcg
atccaccggcgagaggagtttgacctggatgtggttgctgtggtgaacgacacagtcgga
actatgatgacctgtggctttgaagaccctcactgtgaagttggcctcattgttggcacg
ggcagcaatgcctgctacatggaggagatgcgcaacgtggaactggtggaaggagaagag
gggcggatgtgtgtgaacatggaatggggggccttcggggacaatggatgcctagatgac
ttccgcacagaatttgatgtggctgtggatgagctttcactcaaccccggcaagcagagg
ttcgagaaaatgatcagtggaatgtacctgggtgagattgtccgtaacattctcatcgat
ttcaccaagcgtggactactcttccgaggccgcatctcagagcggctcaagacaaggggc
atctttgaaaccaagttcttgtctcagattgagagtgactgcctggccctgctgcaagtc
cgagccatcctgcaacacttagggcttgagagcacctgtgacgacagcatcattgttaag
gaggtgtgcactgtggtggcccggcgggcagcccagctctgtggcgcaggcatggccgct
gtggtggacaggatacgagaaaaccgtgggctggacgctctcaaagtgacagtgggtgtg
gatgggaccctctacaagctacatcctcactttgccaaagtcatgcatgagacagtgaag
gacctggctccgaaatgtgatgtgtctttcctgcagtcagaggatggcagcgggaagggg
gcggcgctcatcactgctgtggcctgccgcatccgtgaggctggacagcgatag

DBGET integrated database retrieval system