KEGG   Homo sapiens (human): 3101Help
Entry
3101              CDS       T01001                                 

Gene name
HK3, HKIII, HXK3
Definition
hexokinase 3 (white cell) (EC:2.7.1.1)
Orthology
K00844  
hexokinase [EC:2.7.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Butirosin and neomycin biosynthesis
Metabolic pathways
Carbon metabolism
HIF-1 signaling pathway
Insulin signaling pathway
Type II diabetes mellitus
Carbohydrate digestion and absorption
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:hsa01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hsa00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:hsa00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:hsa00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:hsa00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:hsa00520]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis [PATH:hsa00524]
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:hsa04066]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:hsa04910]
Organismal Systems; Digestive system; Carbohydrate digestion and absorption [PATH:hsa04973]
Human Diseases; Endocrine and metabolic diseases; Type II diabetes mellitus [PATH:hsa04930]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q35.2
AA seq 923 aa AA seqDB search
MDSIGSSGLRQGEETLSCSEEGLPGPSDSSELVQECLQQFKVTRAQLQQIQASLLGSMEQ
ALRGQASPAPAVRMLPTYVGSTPHGTEQGDFVVLELGATGASLRVLWVTLTGIEGHRVEP
RSQEFVIPQEVMLGAGQQLFDFAAHCLSEFLDAQPVNKQGLQLGFSFSFPCHQTGLDRST
LISWTKGFRCSGVEGQDVVQLLRDAIRRQGAYNIDVVAVVNDTVGTMMGCEPGVRPCEVG
LVVDTGTNACYMEEARHVAVLDEDRGRVCVSVEWGSFSDDGALGPVLTTFDHTLDHESLN
PGAQRFEKMIGGLYLGELVRLVLAHLARCGVLFGGCTSPALLSQGSILLEHVAEMEDPST
GAARVHAILQDLGLSPGASDVELVQHVCAAVCTRAAQLCAAALAAVLSCLQHSREQQTLQ
VAVATGGRVCERHPRFCSVLQGTVMLLAPECDVSLIPSVDGGGRGVAMVTAVAARLAAHR
RLLEETLAPFRLNHDQLAAVQAQMRKAMAKGLRGEASSLRMLPTFVRATPDGSERGDFLA
LDLGGTNFRVLLVRVTTGVQITSEIYSIPETVAQGSGQQLFDHIVDCIVDFQQKQGLSGQ
SLPLGFTFSFPCRQLGLDQGILLNWTKGFKASDCEGQDVVSLLREAITRRQAVELNVVAI
VNDTVGTMMSCGYEDPRCEIGLIVGTGTNACYMEELRNVAGVPGDSGRMCINMEWGAFGD
DGSLAMLSTRFDASVDQASINPGKQRFEKMISGMYLGEIVRHILLHLTSLGVLFRGQQIQ
RLQTRDIFKTKFLSEIESDSLALRQVRAILEDLGLPLTSDDALMVLEVCQAVSQRAAQLC
GAGVAAVVEKIRENRGLEELAVSVGVDGTLYKLHPRFSSLVAATVRELAPRCVVTFLQSE
DGSGKGAALVTAVACRLAQLTRV
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atggactccattgggtcttcagggttgcggcagggggaagaaaccctgagttgctctgag
gagggcttgcccgggccctcagacagctcagagctggtgcaggagtgcctgcagcagttc
aaggtgacaagggcacagctacagcagatccaagccagcctcttgggttccatggagcag
gcgctgaggggacaggccagccctgcccctgcggtccggatgctgcctacatacgtgggg
tccaccccacatggcactgagcaaggagacttcgtggtgctggagctgggggccacaggg
gcctcactgcgtgttttgtgggtgactctaactggcattgaggggcatagggtggagccc
agaagccaggagtttgtgatcccccaagaggtgatgctgggtgctggccagcagctcttt
gactttgctgcccactgcctgtctgagttcctggatgcgcagcctgtgaacaaacagggt
ctgcagcttggcttcagcttctctttcccttgtcaccagacgggcttggacaggagcacc
ctcatttcctggaccaaaggttttaggtgcagtggtgtggaaggccaggatgtggtccag
ctgctgagagatgccattcggaggcagggggcctacaacatcgacgtggttgctgtggtg
aacgacacagtgggcaccatgatgggctgtgagccgggggtcaggccgtgtgaggttggg
ctagttgtagacacgggcaccaacgcgtgttacatggaggaggcacggcatgtggcagtg
ctggacgaagaccggggccgcgtctgcgtcagcgtcgagtggggctccttcagcgatgat
ggggcgctgggaccagtgctgaccaccttcgaccataccctggaccatgagtccctgaat
cctggtgctcagaggtttgagaagatgatcggaggcctgtacctgggtgagctggtgcgg
ctggtgctggctcacttggcccggtgtggggtcctctttggtggctgcacctcccctgcc
ctgctgagccaaggcagcatcctcctggaacacgtggctgagatggaggacccctctact
ggggcagcccgtgtccatgctatcctgcaggacttgggcctgagccctggggcttcggat
gttgagcttgtgcagcacgtctgtgcggccgtgtgcacgcgggctgcccagctctgtgct
gccgccctggccgctgttctctcctgcctccagcacagccgggagcaacaaacactccag
gttgctgtggccaccggaggccgagtgtgtgagcggcaccccaggttctgcagcgtcctg
caggggacagtgatgctcctggccccggaatgcgatgtctccttaatcccctctgtggat
ggtggtggccggggagtggcgatggtgactgccgtggctgcccgtctggctgcccaccgg
cgcctgctggaggagaccctggccccattccggttgaaccatgatcaactggctgcggtt
caggcacagatgcggaaggccatggccaaggggctccgaggggaggcctcctcccttcgc
atgctgcccactttcgtccgggccacccctgacggcagcgagcgaggggatttcctggcc
ctggacctcgggggcacgaacttccgtgtcctcctggtacgtgtgaccacaggcgtgcag
atcaccagcgagatctactccattcccgagactgtggcccagggttctgggcagcagctc
tttgaccacatcgtggactgcatcgtggacttccagcagaagcagggcctgagcgggcag
agcctcccactgggttttaccttctccttcccatgtaggcagcttggcctagaccagggc
atcctcctgaactggaccaagggtttcaaggcatcagactgcgagggccaagatgtcgtg
agtctgttgcgggaagccatcactcgcagacaggcagtggagctgaatgtggttgccatt
gtcaatgacacggtggggaccatgatgtcctgtggctatgaggacccccgttgcgagata
ggcctcattgtcggaaccggcaccaatgcctgctacatggaggagctccggaatgtggcg
ggcgtgcctggggactcaggccgcatgtgcatcaacatggagtggggcgcctttggggac
gatggctctctggccatgctcagcacccgctttgatgcaagtgtggaccaggcgtccatc
aaccccggcaagcagaggtttgaaaagatgatcagcggcatgtacctgggggagatcgtc
cgccacatccttttacatttaaccagccttggcgttctcttccggggccagcagatccag
cgccttcagaccagggacatcttcaagaccaagttcctctctgagatcgaaagtgacagc
ctggccctgcggcaggtccgagccatcctagaggatctggggctacccctgacctcagat
gacgccctgatggtgctagaggtgtgccaggctgtgtcccagagggctgcccagctctgt
ggggcgggtgtagctgccgtggtggagaagatccgggagaaccggggcctggaagagctg
gcagtgtctgtgggggtggatggaacgctctacaagctgcacccgcgcttctccagcctg
gtggcggccacagtgcgggagctggcccctcgctgtgtggtcacgttcctgcagtcagag
gatgggtccggcaaaggtgcggccctggtcaccgctgttgcctgccgccttgcgcagttg
actcgtgtctga

DBGET integrated database retrieval system