KEGG   Homo sapiens (human): 3101Help
Entry
3101              CDS       T01001                                 

Gene name
HK3, HKIII, HXK3
Definition
hexokinase 3 (white cell) (EC:2.7.1.1)
Orthology
K00844  
hexokinase [EC:2.7.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Butirosin and neomycin biosynthesis
Metabolic pathways
Carbon metabolism
HIF-1 signaling pathway
Insulin signaling pathway
Type II diabetes mellitus
Carbohydrate digestion and absorption
Central carbon metabolism in cancer
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    3101 (HK3)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    3101 (HK3)
   00051 Fructose and mannose metabolism
    3101 (HK3)
   00052 Galactose metabolism
    3101 (HK3)
   00500 Starch and sucrose metabolism
    3101 (HK3)
   00520 Amino sugar and nucleotide sugar metabolism
    3101 (HK3)
  Biosynthesis of other secondary metabolites
   00524 Butirosin and neomycin biosynthesis
    3101 (HK3)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    3101 (HK3)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    3101 (HK3)
  Digestive system
   04973 Carbohydrate digestion and absorption
    3101 (HK3)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    3101 (HK3)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    3101 (HK3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     3101 (HK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q35.2
AA seq 923 aa AA seqDB search
MDSIGSSGLRQGEETLSCSEEGLPGPSDSSELVQECLQQFKVTRAQLQQIQASLLGSMEQ
ALRGQASPAPAVRMLPTYVGSTPHGTEQGDFVVLELGATGASLRVLWVTLTGIEGHRVEP
RSQEFVIPQEVMLGAGQQLFDFAAHCLSEFLDAQPVNKQGLQLGFSFSFPCHQTGLDRST
LISWTKGFRCSGVEGQDVVQLLRDAIRRQGAYNIDVVAVVNDTVGTMMGCEPGVRPCEVG
LVVDTGTNACYMEEARHVAVLDEDRGRVCVSVEWGSFSDDGALGPVLTTFDHTLDHESLN
PGAQRFEKMIGGLYLGELVRLVLAHLARCGVLFGGCTSPALLSQGSILLEHVAEMEDPST
GAARVHAILQDLGLSPGASDVELVQHVCAAVCTRAAQLCAAALAAVLSCLQHSREQQTLQ
VAVATGGRVCERHPRFCSVLQGTVMLLAPECDVSLIPSVDGGGRGVAMVTAVAARLAAHR
RLLEETLAPFRLNHDQLAAVQAQMRKAMAKGLRGEASSLRMLPTFVRATPDGSERGDFLA
LDLGGTNFRVLLVRVTTGVQITSEIYSIPETVAQGSGQQLFDHIVDCIVDFQQKQGLSGQ
SLPLGFTFSFPCRQLGLDQGILLNWTKGFKASDCEGQDVVSLLREAITRRQAVELNVVAI
VNDTVGTMMSCGYEDPRCEIGLIVGTGTNACYMEELRNVAGVPGDSGRMCINMEWGAFGD
DGSLAMLSTRFDASVDQASINPGKQRFEKMISGMYLGEIVRHILLHLTSLGVLFRGQQIQ
RLQTRDIFKTKFLSEIESDSLALRQVRAILEDLGLPLTSDDALMVLEVCQAVSQRAAQLC
GAGVAAVVEKIRENRGLEELAVSVGVDGTLYKLHPRFSSLVAATVRELAPRCVVTFLQSE
DGSGKGAALVTAVACRLAQLTRV
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atggactccattgggtcttcagggttgcggcagggggaagaaaccctgagttgctctgag
gagggcttgcccgggccctcagacagctcagagctggtgcaggagtgcctgcagcagttc
aaggtgacaagggcacagctacagcagatccaagccagcctcttgggttccatggagcag
gcgctgaggggacaggccagccctgcccctgcggtccggatgctgcctacatacgtgggg
tccaccccacatggcactgagcaaggagacttcgtggtgctggagctgggggccacaggg
gcctcactgcgtgttttgtgggtgactctaactggcattgaggggcatagggtggagccc
agaagccaggagtttgtgatcccccaagaggtgatgctgggtgctggccagcagctcttt
gactttgctgcccactgcctgtctgagttcctggatgcgcagcctgtgaacaaacagggt
ctgcagcttggcttcagcttctctttcccttgtcaccagacgggcttggacaggagcacc
ctcatttcctggaccaaaggttttaggtgcagtggtgtggaaggccaggatgtggtccag
ctgctgagagatgccattcggaggcagggggcctacaacatcgacgtggttgctgtggtg
aacgacacagtgggcaccatgatgggctgtgagccgggggtcaggccgtgtgaggttggg
ctagttgtagacacgggcaccaacgcgtgttacatggaggaggcacggcatgtggcagtg
ctggacgaagaccggggccgcgtctgcgtcagcgtcgagtggggctccttcagcgatgat
ggggcgctgggaccagtgctgaccaccttcgaccataccctggaccatgagtccctgaat
cctggtgctcagaggtttgagaagatgatcggaggcctgtacctgggtgagctggtgcgg
ctggtgctggctcacttggcccggtgtggggtcctctttggtggctgcacctcccctgcc
ctgctgagccaaggcagcatcctcctggaacacgtggctgagatggaggacccctctact
ggggcagcccgtgtccatgctatcctgcaggacttgggcctgagccctggggcttcggat
gttgagcttgtgcagcacgtctgtgcggccgtgtgcacgcgggctgcccagctctgtgct
gccgccctggccgctgttctctcctgcctccagcacagccgggagcaacaaacactccag
gttgctgtggccaccggaggccgagtgtgtgagcggcaccccaggttctgcagcgtcctg
caggggacagtgatgctcctggccccggaatgcgatgtctccttaatcccctctgtggat
ggtggtggccggggagtggcgatggtgactgccgtggctgcccgtctggctgcccaccgg
cgcctgctggaggagaccctggccccattccggttgaaccatgatcaactggctgcggtt
caggcacagatgcggaaggccatggccaaggggctccgaggggaggcctcctcccttcgc
atgctgcccactttcgtccgggccacccctgacggcagcgagcgaggggatttcctggcc
ctggacctcgggggcacgaacttccgtgtcctcctggtacgtgtgaccacaggcgtgcag
atcaccagcgagatctactccattcccgagactgtggcccagggttctgggcagcagctc
tttgaccacatcgtggactgcatcgtggacttccagcagaagcagggcctgagcgggcag
agcctcccactgggttttaccttctccttcccatgtaggcagcttggcctagaccagggc
atcctcctgaactggaccaagggtttcaaggcatcagactgcgagggccaagatgtcgtg
agtctgttgcgggaagccatcactcgcagacaggcagtggagctgaatgtggttgccatt
gtcaatgacacggtggggaccatgatgtcctgtggctatgaggacccccgttgcgagata
ggcctcattgtcggaaccggcaccaatgcctgctacatggaggagctccggaatgtggcg
ggcgtgcctggggactcaggccgcatgtgcatcaacatggagtggggcgcctttggggac
gatggctctctggccatgctcagcacccgctttgatgcaagtgtggaccaggcgtccatc
aaccccggcaagcagaggtttgaaaagatgatcagcggcatgtacctgggggagatcgtc
cgccacatccttttacatttaaccagccttggcgttctcttccggggccagcagatccag
cgccttcagaccagggacatcttcaagaccaagttcctctctgagatcgaaagtgacagc
ctggccctgcggcaggtccgagccatcctagaggatctggggctacccctgacctcagat
gacgccctgatggtgctagaggtgtgccaggctgtgtcccagagggctgcccagctctgt
ggggcgggtgtagctgccgtggtggagaagatccgggagaaccggggcctggaagagctg
gcagtgtctgtgggggtggatggaacgctctacaagctgcacccgcgcttctccagcctg
gtggcggccacagtgcgggagctggcccctcgctgtgtggtcacgttcctgcagtcagag
gatgggtccggcaaaggtgcggccctggtcaccgctgttgcctgccgccttgcgcagttg
actcgtgtctga

DBGET integrated database retrieval system