KEGG   Homo sapiens (human): 3120Help
Entry
3120              CDS       T01001                                 

Gene name
HLA-DQB2, HLA-DQB1, HLA-DXB
Definition
major histocompatibility complex, class II, DQ beta 2
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p21
AA seq 227 aa AA seqDB search
MALQIPGGFWAAAVTVMLVMLSTPVAEARDFPKDFLVQFKGMCYFTNGTERVRGVARYIY
NREEYGRFDSDVGEFQAVTELGRSIEDWNNYKDFLEQERAAVDKVCRHNYEAELRTTLQR
QVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETAGVVSTSLIRNGDW
TFQILVMLEITPQRGDIYTCQVEHPSLQSPITVEWRPRGPPPAGLLH
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggctctgcagatccctggaggcttttgggcagcagctgtgaccgtgatgctggtgatg
ctgagcaccccagtggctgaggccagagactttcccaaggatttcttggtccagtttaag
ggcatgtgctacttcaccaacgggacagagcgcgtgcgcggtgtggccagatacatctat
aaccgcgaggagtacgggcgcttcgacagcgacgttggggagttccaggcggtgaccgag
ctggggcggagcatcgaggactggaacaactataaggacttcttggagcaggagcgggcc
gcggtggacaaggtgtgcagacacaactacgaggcggagctgcgcacgaccttgcagcgg
caagtggagcccacagtgaccatctccccatccaggacagaggccctcaaccaccacaac
ctgctggtctgctcggtgacagatttctatccagcccagatcaaagtccggtggtttcgg
aatgaccaggaggagacagccggtgttgtgtccacctccctcattaggaatggtgactgg
accttccagattctggtgatgctggaaataactccccagcgtggagacatctacacctgc
caagtggagcaccccagcctccagagccccatcaccgtggagtggcgacctcgagggcct
ccaccagcaggactcctgcactga

DBGET integrated database retrieval system