KEGG   Homo sapiens (human): 313Help
Entry
313               CDS       T01001                                 

Gene name
AOAH
Definition
(RefSeq) acyloxyacyl hydrolase (EC:3.1.1.77)
  KO
K01065  
acyloxyacyl hydrolase [EC:3.1.1.77]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.77  acyloxyacyl hydrolase
     313 (AOAH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7p14.2
AA seq 575 aa AA seqDB search
MQSPWKILTVAPLFLLLSLQSSASPANDDQSRPSLSNGHTCVGCVLVVSVIEQLAQVHNS
TVQASMERLCSYLPEKLFLKTTCYLVIDKFGSDIIKLLSADMNADVVCHTLEFCKQNTGQ
PLCHLYPLPKETWKFTLQKARQIVKKSPILKYSRSGSDICSLPVLAKICQKIKLAMEQSV
PFKDVDSDKYSVFPTLRGYHWRGRDCNDSDESVYPGRRPNNWDVHQDSNCNGIWGVDPKD
GVPYEKKFCEGSQPRGIILLGDSAGAHFHISPEWITASQMSLNSFINLPTALTNELDWPQ
LSGATGFLDSTVGIKEKSIYLRLWKRNHCNHRDYQNISRNGASSRNLKKFIESLSRNKVL
DYPAIVIYAMIGNDVCSGKSDPVPAMTTPEKLYSNVMQTLKHLNSHLPNGSHVILYGLPD
GTFLWDNLHNRYHPLGQLNKDMTYAQLYSFLNCLQVSPCHGWMSSNKTLRTLTSERAEQL
SNTLKKIAASEKFTNFNLFYMDFAFHEIIQEWQKRGGQPWQLIEPVDGFHPNEVALLLLA
DHFWKKVQLQWPQILGKENPFNPQIKQVFGDQGGH
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgcagtccccctggaaaatccttacggtggcgcctctattcttgctcctgtctcttcag
tcctcggcctctccagccaacgatgaccagtccaggcccagcctctcgaatgggcacacc
tgtgtagggtgtgtgctggtggtgtctgtaatagaacagcttgctcaagttcacaactcg
acggtccaggcctcgatggagagactgtgcagctacctgcctgaaaaactgttcttgaaa
accacctgctatttagtcattgacaagtttggatcagacatcataaaactgcttagcgca
gatatgaatgctgatgtggtatgtcacactctggagttttgtaaacagaacactggccaa
ccattgtgtcatctctaccctcttcccaaggagacatggaaatttacactacagaaggca
agacaaattgtcaagaagtccccgattctgaaatattctagaagtggttctgacatttgt
tcactcccggttttggccaagatctgccagaaaattaaattagctatggaacagtctgtg
ccattcaaagatgtggattcagacaaatacagcgttttcccaacactgcggggctatcac
tggcgggggagagactgtaatgacagcgacgagtcagtgtacccaggtagaaggccgaac
aactgggatgtccatcaggattcaaactgtaatggcatttggggtgtcgatccaaaagat
ggagttccatatgagaagaaattctgtgaaggttcacagcccaggggaatcattttgctg
ggagactcagctggggctcattttcacatctctcctgaatggatcacagcgtcgcagatg
tctttgaactctttcatcaatctaccaacagcccttaccaacgagcttgactggccccaa
ctctctggtgctacaggatttctggactccactgttggaattaaagaaaaatctatttac
cttcgcttatggaaaagaaaccactgtaatcacagggactaccagaatatttcaagaaat
ggtgcatcttcccgaaacctgaagaaatttatagaaagcttgtctagaaacaaggtgttg
gactatcccgccatcgttatatatgccatgattggaaatgatgtctgcagtgggaagagt
gacccagtcccagccatgaccactcctgagaaactctactccaacgtcatgcagactctg
aagcatctaaattcccacctgcccaatggcagccatgttattttgtatggcttaccagat
ggaacctttctctgggataatttgcacaacagatatcatcctctcggccagctaaataaa
gacatgacctatgcgcagttgtactccttcctgaactgcctccaggtcagcccctgccac
ggctggatgtcttccaacaagacgttgcggactctcacttcagagagagcagagcaactc
tccaacacactgaaaaaaattgcagccagtgagaaatttacaaacttcaatcttttctac
atggattttgccttccatgaaatcatacaggagtggcagaagagaggcggacagccctgg
cagctcatcgagcccgtggatggattccaccccaacgaggtggctttgctgttgttggcg
gatcatttctggaaaaaggtgcagctccagtggccccaaatcctgggaaaggagaatccg
ttcaacccccagattaaacaggtgtttggagaccaaggcgggcactga

DBGET integrated database retrieval system