KEGG   Homo sapiens (human): 314Help
Entry
314               CDS       T01001                                 

Gene name
AOC2, DAO2, RAO
Definition
amine oxidase, copper containing 2 (retina-specific) (EC:1.4.3.21)
Orthology
K00276  
primary-amine oxidase [EC:1.4.3.21]
Organism
hsa  Homo sapiens (human)
Pathway
Glycine, serine and threonine metabolism
Tyrosine metabolism
Phenylalanine metabolism
beta-Alanine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    314 (AOC2)
   00350 Tyrosine metabolism
    314 (AOC2)
   00360 Phenylalanine metabolism
    314 (AOC2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    314 (AOC2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.21  primary-amine oxidase
     314 (AOC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q21
AA seq 729 aa AA seqDB search
MHLKIVLAFLALSLITIFALAYVLLTSPGGSSQPPHCPSVSHRAQPWPHPGQSQLFADLS
REELTAVMRFLTQRLGPGLVDAAQAQPSDNCIFSVELQLPPKAAALAHLDRGSPPPAREA
LAIVLFGGQPQPNVSELVVGPLPHPSYMRDVTVERHGGPLPYHRRPVLRAEFTQMWRHLK
EVELPKAPIFLSSTFNYNGSTLAAVHATPRGLRSGDRATWMALYHNISGVGLFLHPVGLE
LLLDHRALDPAHWTVQQVFYLGHYYADLGQLEREFKSGRLEVVRVPLPPPNGASSLRSRN
SPGPLPPLQFSPQGSQYSVQGNLVVSSLWSFTFGHGVFSGLRIFDVRFQGERIAYEVSVQ
ECVSIYGADSPKTMLTRYLDSSFGLGRNSRGLVRGVDCPYQATMVDIHILVGKGAVQLLP
GAVCVFEEAQGLPLRRHHNYLQNHFYGGLASSALVVRSVSSVGNYDYIWDFVLYPNGALE
GRVHATGYINTAFLKGGEEGLLFGNRVGERVLGTVHTHAFHFKLDLDVAGLKNWVVAEDV
VFKPVAAPWNPEHWLQRPQLTRQVLGKEDLTAFSLGSPLPRYLYLASNQTNAWGHQRGYQ
LVVTQRKEEESQSSSIYHQNDIWTPTVTFADFINNETLLGEDLVAWVTASFLHIPHAEDI
PNTVTLGNRVGFLLRPYNFFDEDPSIFSPGSVYFEKGQDAGLCSINPVACLPDLAACVPD
LPPFSYHGF
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgcatctcaagatagtcctggcgttcctggcactgtccctcattaccatctttgccctg
gcctatgttttgctgaccagcccaggtggttccagccagcctccccactgcccctctgta
tcccatagggcccagccctggccacaccctggccagagccagctgtttgcagacctgagc
cgagaggagttgacagctgtgatgcgctttctgacccagcggctggggccagggctggtg
gacgcagcccaggctcagccctcggacaactgcatcttctcagtggagctgcagctgccc
cccaaggctgcagccctggcccacctggacagggggagccccccacctgcccgggaggca
ctggccatcgtcctctttggtggacaaccccaacccaatgtgagtgagctggtggtgggg
ccgctgcctcacccctcgtacatgcgggatgtgactgtggagcgtcacggcgggcccctg
ccctatcaccgtcgcccggtgctgagagctgagtttacacagatgtggaggcatctgaaa
gaggtggagctacccaaggcacccatcttcctgtcgtccaccttcaactacaatggctct
accctggcagctgtgcatgccacccctcggggcttgcgctcaggggaccgagctacctgg
atggccctctaccataacatctcaggggttggtcttttccttcaccccgtggggctggag
ctactactggaccacagggccctggaccctgcccactggactgtccagcaggtcttctac
cttgggcactactatgcagacttgggccagttggaacgggagtttaagtctggccggttg
gaagtggttagagtccctctacctccaccaaatggagcttcatccctgaggtctcggaac
tctccaggtcctcttccccctcttcagttctcgccccagggttcccagtacagtgtgcaa
ggaaacctggtggtatcctccctctggtcatttacctttggccatggggtgttcagcggc
ctgaggatttttgatgttcggttccagggtgagcgaatagcctatgaagtcagtgtccag
gagtgtgtatctatctatggtgccgattcacccaagacgatgctgactcgctatttggat
agcagctttggactcggccgtaacagccgaggcttggtgcggggagtggactgcccctat
caagccacgatggtggacatccatatattagtgggcaaaggggcagtccagctgcttcca
ggggctgtgtgtgtatttgaggaagcccagggactgccccttcgaaggcaccacaattac
cttcaaaatcatttctatggtggtttggccagctcagcccttgtggtcaggtctgtgtca
tctgtgggcaactatgactacatttgggactttgtgttgtacccaaatggggcacttgaa
gggcgggtccatgccacgggttatatcaacacagctttcctgaaagggggagaggagggc
ctcctctttgggaaccgtgtgggggaaagagtgctgggaacggtgcacacacatgccttc
cacttcaagctggacctggatgtggcagggctgaaaaactgggtggtagctgaagacgtg
gtgtttaaacctgtggctgccccctggaacccggagcactggctacagcgcccacagctg
actcggcaggtcctgggaaaggaggacctgacagctttttccttgggaagccccctaccc
cgctacctctacctggctagcaaccagactaatgcgtggggtcaccagcgcggataccag
cttgtggtgacccagagaaaggaggaggagtcacagagcagtagcatctatcaccagaat
gacatctggacacccacagttacctttgctgacttcatcaacaatgaaaccctcttagga
gaggatctggtggcttgggtcacagccagcttcctgcacattccccatgccgaggacatc
ccaaacacagtgactctggggaacagagttggcttcttgctccgaccctataacttcttt
gatgaggacccctccatcttctcccctggcagtgtctactttgagaagggccaggatgct
gggctctgcagcatcaatcctgtggcctgcctccccgacctggcagcctgtgtcccggac
ttaccccctttctcttaccacggcttctag

DBGET integrated database retrieval system