KEGG   Homo sapiens (human): 3146Help
Entry
3146              CDS       T01001                                 

Gene name
HMGB1, HMG-1, HMG1, HMG3, SBP-1
Definition
(RefSeq) high mobility group box 1
  KO
K10802  
high mobility group protein B1
Organism
hsa  Homo sapiens (human)
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    3146 (HMGB1)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Nucleosome assembly factors
   HMG (high mobility group) proteins
    3146 (HMGB1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     3146 (HMGB1)
   MMR (mismatch exicision repair)
    Other MMR factors
     3146 (HMGB1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   3146 (HMGB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
13q12
AA seq 215 aa AA seqDB search
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKF
EDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGL
SIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEK
SKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaaggagatcctaagaagccgagaggcaaaatgtcatcatatgcattttttgtg
caaacttgtcgggaggagcataagaagaagcacccagatgcttcagtcaacttctcagag
ttttctaagaagtgctcagagaggtggaagaccatgtctgctaaagagaaaggaaaattt
gaagatatggcaaaagcggacaaggcccgttatgaaagagaaatgaaaacctatatccct
cccaaaggggagacaaaaaagaagttcaaggatcccaatgcacccaagaggcctccttcg
gccttcttcctcttctgctctgagtatcgcccaaaaatcaaaggagaacatcctggcctg
tccattggtgatgttgcgaagaaactgggagagatgtggaataacactgctgcagatgac
aagcagccttatgaaaagaaggctgcgaagctgaaggaaaaatacgaaaaggatattgct
gcatatcgagctaaaggaaagcctgatgcagcaaaaaagggagttgtcaaggctgaaaaa
agcaagaaaaagaaggaagaggaggaagatgaggaagatgaagaggatgaggaggaggag
gaagatgaagaagatgaagatgaagaagaagatgatgatgatgaataa

DBGET integrated database retrieval system