KEGG   Homo sapiens (human): 3157Help
Entry
3157              CDS       T01001                                 

Gene name
HMGCS1, HMGCS
Definition
(RefSeq) 3-hydroxy-3-methylglutaryl-CoA synthase 1
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00072  Synthesis and degradation of ketone bodies
hsa00280  Valine, leucine and isoleucine degradation
hsa00650  Butanoate metabolism
hsa00900  Terpenoid backbone biosynthesis
hsa01100  Metabolic pathways
Module
hsa_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    3157 (HMGCS1)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    3157 (HMGCS1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    3157 (HMGCS1)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    3157 (HMGCS1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     3157 (HMGCS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HMG_CoA_synt_C HMG_CoA_synt_N ACP_syn_III
Motif
Other DBs
NCBI-GeneID: 3157
NCBI-ProteinID: NP_001091742
OMIM: 142940
HGNC: 5007
Ensembl: ENSG00000112972
Vega: OTTHUMG00000162231
Pharos: Q01581(Tbio)
UniProt: Q01581 A0A024R059
Structure
PDB: 

Jmol
Position
5p12
AA seq 520 aa AA seqDB search
MPGSLPLNAEACWPKDVGIVALEIYFPSQYVDQAELEKYDGVDAGKYTIGLGQAKMGFCT
DREDINSLCMTVVQNLMERNNLSYDCIGRLEVGTETIIDKSKSVKTNLMQLFEESGNTDI
EGIDTTNACYGGTAAVFNAVNWIESSSWDGRYALVVAGDIAVYATGNARPTGGVGAVALL
IGPNAPLIFERGLRGTHMQHAYDFYKPDMLSEYPIVDGKLSIQCYLSALDRCYSVYCKKI
HAQWQKEGNDKDFTLNDFGFMIFHSPYCKLVQKSLARMLLNDFLNDQNRDKNSIYSGLEA
FGDVKLEDTYFDRDVEKAFMKASSELFSQKTKASLLVSNQNGNMYTSSVYGSLASVLAQY
SPQQLAGKRIGVFSYGSGLAATLYSLKVTQDATPGSALDKITASLCDLKSRLDSRTGVAP
DVFAENMKLREDTHHLVNYIPQGSIDSLFEGTWYLVRVDEKHRRTYARRPTPNDDTLDEG
VGLVHSNIATEHIPSPAKKVPRLPATAAEPEAAVISNGEH
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgcctggatcacttcctttgaatgcagaagcttgctggccaaaagatgtgggaattgtt
gcccttgagatctattttccttctcaatatgttgatcaagcagagttggaaaaatatgat
ggtgtagatgctggaaagtataccattggcttgggccaggccaagatgggcttctgcaca
gatagagaagatattaactctctttgcatgactgtggttcagaatcttatggagagaaat
aacctttcctatgattgcattgggcggctggaagttggaacagagacaatcatcgacaaa
tcaaagtctgtgaagactaatttgatgcagctgtttgaagagtctgggaatacagatata
gaaggaatcgacacaactaatgcatgctatggaggcacagctgctgtcttcaatgctgtt
aactggattgagtccagctcttgggatggacggtatgccctggtagttgcaggagatatt
gctgtatatgccacaggaaatgctagacctacaggtggagttggagcagtagctctgcta
attgggccaaatgctcctttaatttttgaacgagggcttcgtgggacacatatgcaacat
gcctatgatttttacaagcctgatatgctatctgaatatcctatagtagatggaaaactc
tccatacagtgctacctcagtgcattagaccgctgctattctgtctactgcaaaaagatc
catgcccagtggcagaaagagggaaatgataaagattttaccttgaatgattttggcttc
atgatctttcactcaccatattgtaaactggttcagaaatctctagctcggatgttgctg
aatgacttccttaatgaccagaatagagataaaaatagtatctatagtggcctggaagcc
tttggggatgttaaattagaagacacctactttgatagagatgtggagaaggcatttatg
aaggctagctctgaactcttcagtcagaaaacaaaggcatctttacttgtatcaaatcaa
aatggaaatatgtacacatcttcagtatatggttcccttgcatctgttctagcacagtac
tcacctcagcaattagcagggaagagaattggagtgttttcttatggttctggtttggct
gccactctgtactctcttaaagtcacacaagatgctacaccggggtctgctcttgataaa
ataacagcaagtttatgtgatcttaaatcaaggcttgattcaagaactggtgtggcacca
gatgtcttcgctgaaaacatgaagctcagagaggacacccatcatttggtcaactatatt
ccccagggttcaatagattcactctttgaaggaacgtggtacttagttagggtggatgaa
aagcacagaagaacttacgctcggcgtcccactccaaatgatgacactttggatgaagga
gtaggacttgtgcattcaaacatagcaactgagcatattccaagccctgccaagaaagta
ccaagactccctgccacagcagcagaacctgaagcagctgtcattagtaatggggaacat
taa

DBGET integrated database retrieval system