KEGG   Homo sapiens (human): 3162Help
Entry
3162              CDS       T01001                                 

Gene name
HMOX1, HMOX1D, HO-1, HSP32, bK286B10
Definition
(RefSeq) heme oxygenase 1
  KO
K00510  
heme oxygenase (biliverdin-producing) [EC:1.14.14.18]
Organism
hsa  Homo sapiens (human)
Pathway
Porphyrin and chlorophyll metabolism
HIF-1 signaling pathway
Mineral absorption
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    3162 (HMOX1)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    3162 (HMOX1)
 Organismal Systems
  Digestive system
   04978 Mineral absorption
    3162 (HMOX1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    3162 (HMOX1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.18  heme oxygenase (biliverdin-producing)
     3162 (HMOX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
22q13.1
AA seq 288 aa AA seqDB search
MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVA
LEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHE
VGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQ
LYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRA
SNKVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVATVAVGLYAM
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggagcgtccgcaacccgacagcatgccccaggatttgtcagaggccctgaaggaggcc
accaaggaggtgcacacccaggcagagaatgctgagttcatgaggaactttcagaagggc
caggtgacccgagacggcttcaagctggtgatggcctccctgtaccacatctatgtggcc
ctggaggaggagattgagcgcaacaaggagagcccagtcttcgcccctgtctacttccca
gaagagctgcaccgcaaggctgccctggagcaggacctggccttctggtacgggccccgc
tggcaggaggtcatcccctacacaccagccatgcagcgctatgtgaagcggctccacgag
gtggggcgcacagagcccgagctgctggtggcccacgcctacacccgctacctgggtgac
ctgtctgggggccaggtgctcaaaaagattgcccagaaagccctggacctgcccagctct
ggcgagggcctggccttcttcaccttccccaacattgccagtgccaccaagttcaagcag
ctctaccgctcccgcatgaactccctggagatgactcccgcagtcaggcagagggtgata
gaagaggccaagactgcgttcctgctcaacatccagctctttgaggagttgcaggagctg
ctgacccatgacaccaaggaccagagcccctcacgggcaccagggcttcgccagcgggcc
agcaacaaagtgcaagattctgcccccgtggagactcccagagggaagcccccactcaac
acccgctcccaggctccgcttctccgatgggtccttacactcagctttctggtggcgaca
gttgctgtagggctttatgccatgtga

DBGET integrated database retrieval system