KEGG   Homo sapiens (human): 3162Help
Entry
3162              CDS       T01001                                 

Gene name
HMOX1, HMOX1D, HO-1, HSP32, bK286B10
Definition
(RefSeq) heme oxygenase 1
  KO
K00510  heme oxygenase 1 [EC:1.14.14.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00860  Porphyrin and chlorophyll metabolism
hsa01100  Metabolic pathways
hsa04066  HIF-1 signaling pathway
hsa04216  Ferroptosis
hsa04978  Mineral absorption
hsa05200  Pathways in cancer
hsa05206  MicroRNAs in cancer
hsa05225  Hepatocellular carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Network
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    3162 (HMOX1)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    3162 (HMOX1)
 Cellular Processes
  Cell growth and death
   04216 Ferroptosis
    3162 (HMOX1)
 Organismal Systems
  Digestive system
   04978 Mineral absorption
    3162 (HMOX1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    3162 (HMOX1)
   05206 MicroRNAs in cancer
    3162 (HMOX1)
   05225 Hepatocellular carcinoma
    3162 (HMOX1)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    3162 (HMOX1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.18  heme oxygenase (biliverdin-producing)
     3162 (HMOX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Heme_oxygenase
Motif
Other DBs
NCBI-GeneID: 3162
NCBI-ProteinID: NP_002124
OMIM: 141250
HGNC: 5013
Ensembl: ENSG00000100292
Vega: OTTHUMG00000150960
Pharos: P09601(Tbio)
UniProt: P09601 Q6FH11
Structure
PDB: 

Jmol
Position
22q12.3
AA seq 288 aa AA seqDB search
MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVA
LEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHE
VGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQ
LYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRA
SNKVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVATVAVGLYAM
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggagcgtccgcaacccgacagcatgccccaggatttgtcagaggccctgaaggaggcc
accaaggaggtgcacacccaggcagagaatgctgagttcatgaggaactttcagaagggc
caggtgacccgagacggcttcaagctggtgatggcctccctgtaccacatctatgtggcc
ctggaggaggagattgagcgcaacaaggagagcccagtcttcgcccctgtctacttccca
gaagagctgcaccgcaaggctgccctggagcaggacctggccttctggtacgggccccgc
tggcaggaggtcatcccctacacaccagccatgcagcgctatgtgaagcggctccacgag
gtggggcgcacagagcccgagctgctggtggcccacgcctacacccgctacctgggtgac
ctgtctgggggccaggtgctcaaaaagattgcccagaaagccctggacctgcccagctct
ggcgagggcctggccttcttcaccttccccaacattgccagtgccaccaagttcaagcag
ctctaccgctcccgcatgaactccctggagatgactcccgcagtcaggcagagggtgata
gaagaggccaagactgcgttcctgctcaacatccagctctttgaggagttgcaggagctg
ctgacccatgacaccaaggaccagagcccctcacgggcaccagggcttcgccagcgggcc
agcaacaaagtgcaagattctgcccccgtggagactcccagagggaagcccccactcaac
acccgctcccaggctccgcttctccgatgggtccttacactcagctttctggtggcgaca
gttgctgtagggctttatgccatgtga

DBGET integrated database retrieval system