KEGG   Homo sapiens (human): 3162Help
Entry
3162              CDS       T01001                                 

Gene name
HMOX1, HMOX1D, HO-1, HSP32, bK286B10
Definition
heme oxygenase (decycling) 1 (EC:1.14.99.3)
Orthology
K00510  
heme oxygenase [EC:1.14.99.3]
Organism
hsa  Homo sapiens (human)
Pathway
Porphyrin and chlorophyll metabolism
HIF-1 signaling pathway
Mineral absorption
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    3162 (HMOX1)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    3162 (HMOX1)
 Organismal Systems
  Digestive system
   04978 Mineral absorption
    3162 (HMOX1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    3162 (HMOX1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.3  heme oxygenase (biliverdin-producing)
     3162 (HMOX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
22q13.1
AA seq 288 aa AA seqDB search
MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVA
LEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHE
VGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQ
LYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRA
SNKVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVATVAVGLYAM
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggagcgtccgcaacccgacagcatgccccaggatttgtcagaggccctgaaggaggcc
accaaggaggtgcacacccaggcagagaatgctgagttcatgaggaactttcagaagggc
caggtgacccgagacggcttcaagctggtgatggcctccctgtaccacatctatgtggcc
ctggaggaggagattgagcgcaacaaggagagcccagtcttcgcccctgtctacttccca
gaagagctgcaccgcaaggctgccctggagcaggacctggccttctggtacgggccccgc
tggcaggaggtcatcccctacacaccagccatgcagcgctatgtgaagcggctccacgag
gtggggcgcacagagcccgagctgctggtggcccacgcctacacccgctacctgggtgac
ctgtctgggggccaggtgctcaaaaagattgcccagaaagccctggacctgcccagctct
ggcgagggcctggccttcttcaccttccccaacattgccagtgccaccaagttcaagcag
ctctaccgctcccgcatgaactccctggagatgactcccgcagtcaggcagagggtgata
gaagaggccaagactgcgttcctgctcaacatccagctctttgaggagttgcaggagctg
ctgacccatgacaccaaggaccagagcccctcacgggcaccagggcttcgccagcgggcc
agcaacaaagtgcaagattctgcccccgtggagactcccagagggaagcccccactcaac
acccgctcccaggctccgcttctccgatgggtccttacactcagctttctggtggcgaca
gttgctgtagggctttatgccatgtga

DBGET integrated database retrieval system