KEGG   Homo sapiens (human): 3163Help
Entry
3163              CDS       T01001                                 

Gene name
HMOX2, HO-2
Definition
heme oxygenase (decycling) 2 (EC:1.14.99.3)
Orthology
K00510  
heme oxygenase [EC:1.14.99.3]
Organism
hsa  Homo sapiens (human)
Pathway
Porphyrin and chlorophyll metabolism
Mineral absorption
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:hsa00860]
Organismal Systems; Digestive system; Mineral absorption [PATH:hsa04978]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16p13.3
AA seq 316 aa AA seqDB search
MSAEVETSEGVDESEKKNSGALEKENQMRMADLSELLKEGTKEAHDRAENTQFVKDFLKG
NIKKELFKLATTALYFTYSALEEEMERNKDHPAFAPLYFPMELHRKEALTKDMEYFFGEN
WEEQVQCPKAAQKYVERIHYIGQNEPELLVAHAYTRYMGDLSGGQVLKKVAQRALKLPST
GEGTQFYLFENVDNAQQFKQLYRARMNALDLNMKTKERIVEEANKAFEYNMQIFNELDQA
GSTLARETLEDGFPVHDGKGDMRKCPFYAAEQDKGALEGSSCPFRTAMAVLRKPSLQFIL
AAGVALAAGLLAWYYM
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcggaagtggaaacctcagagggggtagacgagtcagaaaaaaagaactctggg
gccctagaaaaggagaaccaaatgagaatggctgacctctcggagctcctgaaggaaggg
accaaggaagcacacgaccgggcagaaaacacccagtttgtcaaggacttcttgaaaggc
aacattaagaaggagctgtttaagctggccaccacggcactttacttcacatactcagcc
ctcgaggaggaaatggagcgcaacaaggaccatccagcctttgcccctttgtacttcccc
atggagctgcaccggaaggaggcgctgaccaaggacatggagtatttctttggtgaaaac
tgggaggagcaggtgcagtgccccaaggctgcccagaagtacgtggagcggatccactac
atagggcagaacgagccggagctactggtggcccatgcatacacccgctacatgggggat
ctctcggggggccaggtgctgaagaaggtggcccagcgagcactgaaactccccagcaca
ggggaagggacccagttctacctgtttgagaatgtggacaatgcccagcagttcaagcag
ctctaccgggccaggatgaacgccctggacctgaacatgaagaccaaagagaggatcgtg
gaggaggccaacaaggcttttgagtataacatgcagatattcaatgaactggaccaggcc
ggctccacactggccagagagaccttggaggatgggttccctgtacacgatgggaaagga
gacatgcgtaaatgccctttctacgctgctgaacaagacaaaggtgccctggagggcagc
agctgtcccttccgaacagctatggctgtgctgaggaagcccagcctccagttcatcctg
gccgctggtgtggccctagctgctggactcttggcctggtactacatgtga

DBGET integrated database retrieval system