KEGG   Homo sapiens (human): 3163Help
Entry
3163              CDS       T01001                                 

Gene name
HMOX2, HO-2
Definition
(RefSeq) heme oxygenase 2
  KO
K00510  
heme oxygenase (biliverdin-producing) [EC:1.14.14.18]
Organism
hsa  Homo sapiens (human)
Pathway
Porphyrin and chlorophyll metabolism
Mineral absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    3163 (HMOX2)
 Organismal Systems
  Digestive system
   04978 Mineral absorption
    3163 (HMOX2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.18  heme oxygenase (biliverdin-producing)
     3163 (HMOX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16p13.3
AA seq 316 aa AA seqDB search
MSAEVETSEGVDESEKKNSGALEKENQMRMADLSELLKEGTKEAHDRAENTQFVKDFLKG
NIKKELFKLATTALYFTYSALEEEMERNKDHPAFAPLYFPMELHRKEALTKDMEYFFGEN
WEEQVQCPKAAQKYVERIHYIGQNEPELLVAHAYTRYMGDLSGGQVLKKVAQRALKLPST
GEGTQFYLFENVDNAQQFKQLYRARMNALDLNMKTKERIVEEANKAFEYNMQIFNELDQA
GSTLARETLEDGFPVHDGKGDMRKCPFYAAEQDKGALEGSSCPFRTAMAVLRKPSLQFIL
AAGVALAAGLLAWYYM
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcggaagtggaaacctcagagggggtagacgagtcagaaaaaaagaactctggg
gccctagaaaaggagaaccaaatgagaatggctgacctctcggagctcctgaaggaaggg
accaaggaagcacacgaccgggcagaaaacacccagtttgtcaaggacttcttgaaaggc
aacattaagaaggagctgtttaagctggccaccacggcactttacttcacatactcagcc
ctcgaggaggaaatggagcgcaacaaggaccatccagcctttgcccctttgtacttcccc
atggagctgcaccggaaggaggcgctgaccaaggacatggagtatttctttggtgaaaac
tgggaggagcaggtgcagtgccccaaggctgcccagaagtacgtggagcggatccactac
atagggcagaacgagccggagctactggtggcccatgcatacacccgctacatgggggat
ctctcggggggccaggtgctgaagaaggtggcccagcgagcactgaaactccccagcaca
ggggaagggacccagttctacctgtttgagaatgtggacaatgcccagcagttcaagcag
ctctaccgggccaggatgaacgccctggacctgaacatgaagaccaaagagaggatcgtg
gaggaggccaacaaggcttttgagtataacatgcagatattcaatgaactggaccaggcc
ggctccacactggccagagagaccttggaggatgggttccctgtacacgatgggaaagga
gacatgcgtaaatgccctttctacgctgctgaacaagacaaaggtgccctggagggcagc
agctgtcccttccgaacagctatggctgtgctgaggaagcccagcctccagttcatcctg
gccgctggtgtggccctagctgctggactcttggcctggtactacatgtga

DBGET integrated database retrieval system