KEGG   Homo sapiens (human): 3170Help
Entry
3170              CDS       T01001                                 

Gene name
FOXA2, HNF3B, TCF3B
Definition
forkhead box A2
Orthology
K08035  
forkhead box protein A2, hepatocyte nuclear factor 3-beta
Organism
hsa  Homo sapiens (human)
Pathway
Maturity onset diabetes of the young
Class
Human Diseases; Endocrine and metabolic diseases; Maturity onset diabetes of the young [PATH:hsa04950]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
20p11
AA seq 463 aa AA seqDB search
MHSASSMLGAVKMEGHEPSDWSSYYAEPEGYSSVSNMNAGLGMNGMNTYMSMSAAAMGSG
SGNMSAGSMNMSSYVGAGMSPSLAGMSPGAGAMAGMGGSAGAAGVAGMGPHLSPSLSPLG
GQAAGAMGGLAPYANMNSMSPMYGQAGLSRARDPKTYRRSYTHAKPPYSYISLITMAIQQ
SPNKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVPRSPDKPGKGSFWT
LHPDSGNMFENGCYLRRQKRFKCEKQLALKEAAGAAGSGKKAAAGAQASQAQLGEAAGPA
SETPAGTESPHSSASPCQEHKRGGLGELKGTPAAALSPPEPAPSPGQQQQAAAHLLGPPH
HPGLPPEAHLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGY
GSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNSS
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgcactcggcttccagtatgctgggagcggtgaagatggaagggcacgagccgtccgac
tggagcagctactatgcagagcccgagggctactcctccgtgagcaacatgaacgccggc
ctggggatgaacggcatgaacacgtacatgagcatgtcggcggccgccatgggcagcggc
tcgggcaacatgagcgcgggctccatgaacatgtcgtcgtacgtgggcgctggcatgagc
ccgtccctggcggggatgtcccccggcgcgggcgccatggcgggcatgggcggctcggcc
ggggcggccggcgtggcgggcatggggccgcacttgagtcccagcctgagcccgctcggg
gggcaggcggccggggccatgggcggcctggccccctacgccaacatgaactccatgagc
cccatgtacgggcaggcgggcctgagccgcgcccgcgaccccaagacctacaggcgcagc
tacacgcacgcaaagccgccctactcgtacatctcgctcatcaccatggccatccagcag
agccccaacaagatgctgacgctgagcgagatctaccagtggatcatggacctcttcccc
ttctaccggcagaaccagcagcgctggcagaactccatccgccactcgctctccttcaac
gactgtttcctgaaggtgccccgctcgcccgacaagcccggcaagggctccttctggacc
ctgcaccctgactcgggcaacatgttcgagaacggctgctacctgcgccgccagaagcgc
ttcaagtgcgagaagcagctggcgctgaaggaggccgcaggcgccgccggcagcggcaag
aaggcggccgccggagcccaggcctcacaggctcaactcggggaggccgccgggccggcc
tccgagactccggcgggcaccgagtcgcctcactcgagcgcctccccgtgccaggagcac
aagcgagggggcctgggagagctgaaggggacgccggctgcggcgctgagccccccagag
ccggcgccctctcccgggcagcagcagcaggccgcggcccacctgctgggcccgccccac
cacccgggcctgccgcctgaggcccacctgaagccggaacaccactacgccttcaaccac
ccgttctccatcaacaacctcatgtcctcggagcagcagcaccaccacagccaccaccac
caccaaccccacaaaatggacctcaaggcctacgaacaggtgatgcactaccccggctac
ggttcccccatgcctggcagcttggccatgggcccggtcacgaacaaaacgggcctggac
gcctcgcccctggccgcagatacctcctactaccagggggtgtactcccggcccattatg
aactcctcttaa

DBGET integrated database retrieval system