KEGG   Homo sapiens (human): 3170Help
Entry
3170              CDS       T01001                                 

Gene name
FOXA2, HNF3B, TCF3B
Definition
(RefSeq) forkhead box A2
  KO
K08035  
forkhead box protein A2, hepatocyte nuclear factor 3-beta
Organism
hsa  Homo sapiens (human)
Pathway
Longevity regulating pathway - multiple species
Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    3170 (FOXA2)
 Human Diseases
  Endocrine and metabolic diseases
   04950 Maturity onset diabetes of the young
    3170 (FOXA2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Fork head/winged helix developmental regulators
    3170 (FOXA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
20p11
AA seq 457 aa AA seqDB search
MLGAVKMEGHEPSDWSSYYAEPEGYSSVSNMNAGLGMNGMNTYMSMSAAAMGSGSGNMSA
GSMNMSSYVGAGMSPSLAGMSPGAGAMAGMGGSAGAAGVAGMGPHLSPSLSPLGGQAAGA
MGGLAPYANMNSMSPMYGQAGLSRARDPKTYRRSYTHAKPPYSYISLITMAIQQSPNKML
TLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVPRSPDKPGKGSFWTLHPDSG
NMFENGCYLRRQKRFKCEKQLALKEAAGAAGSGKKAAAGAQASQAQLGEAAGPASETPAG
TESPHSSASPCQEHKRGGLGELKGTPAAALSPPEPAPSPGQQQQAAAHLLGPPHHPGLPP
EAHLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGYGSPMPG
SLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNSS
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgctgggagcggtgaagatggaagggcacgagccgtccgactggagcagctactatgca
gagcccgagggctactcctccgtgagcaacatgaacgccggcctggggatgaacggcatg
aacacgtacatgagcatgtcggcggccgccatgggcagcggctcgggcaacatgagcgcg
ggctccatgaacatgtcgtcgtacgtgggcgctggcatgagcccgtccctggcggggatg
tcccccggcgcgggcgccatggcgggcatgggcggctcggccggggcggccggcgtggcg
ggcatggggccgcacttgagtcccagcctgagcccgctcggggggcaggcggccggggcc
atgggcggcctggccccctacgccaacatgaactccatgagccccatgtacgggcaggcg
ggcctgagccgcgcccgcgaccccaagacctacaggcgcagctacacgcacgcaaagccg
ccctactcgtacatctcgctcatcaccatggccatccagcagagccccaacaagatgctg
acgctgagcgagatctaccagtggatcatggacctcttccccttctaccggcagaaccag
cagcgctggcagaactccatccgccactcgctctccttcaacgactgtttcctgaaggtg
ccccgctcgcccgacaagcccggcaagggctccttctggaccctgcaccctgactcgggc
aacatgttcgagaacggctgctacctgcgccgccagaagcgcttcaagtgcgagaagcag
ctggcgctgaaggaggccgcaggcgccgccggcagcggcaagaaggcggccgccggagcc
caggcctcacaggctcaactcggggaggccgccgggccggcctccgagactccggcgggc
accgagtcgcctcactcgagcgcctccccgtgccaggagcacaagcgagggggcctggga
gagctgaaggggacgccggctgcggcgctgagccccccagagccggcgccctctcccggg
cagcagcagcaggccgcggcccacctgctgggcccgccccaccacccgggcctgccgcct
gaggcccacctgaagccggaacaccactacgccttcaaccacccgttctccatcaacaac
ctcatgtcctcggagcagcagcaccaccacagccaccaccaccaccaaccccacaaaatg
gacctcaaggcctacgaacaggtgatgcactaccccggctacggttcccccatgcctggc
agcttggccatgggcccggtcacgaacaaaacgggcctggacgcctcgcccctggccgca
gatacctcctactaccagggggtgtactcccggcccattatgaactcctcttaa

DBGET integrated database retrieval system