KEGG   Homo sapiens (human): 3171Help
Entry
3171              CDS       T01001                                 

Gene name
FOXA3, FKHH3, HNF3G, TCF3G
Definition
forkhead box A3
Orthology
K08038  
forkhead box protein A3, hepatocyte nuclear factor 3-gamma
Organism
hsa  Homo sapiens (human)
Pathway
Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Endocrine and metabolic diseases
   04950 Maturity onset diabetes of the young
    3171 (FOXA3)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Fork head/winged helix tissue-specific regulators
    3171 (FOXA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.2-q13.4
AA seq 350 aa AA seqDB search
MLGSVKMEAHDLAEWSYYPEAGEVYSPVTPVPTMAPLNSYMTLNPLSSPYPPGGLPASPL
PSGPLAPPAPAAPLGPTFPGLGVSGGSSSSGYGAPGPGLVHGKEMPKGYRRPLAHAKPPY
SYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVAR
SPDKPGKGSYWALHPSSGNMFENGCYLRRQKRFKLEEKVKKGGSGAATTTRNGTGSAAST
TTPAATVTSPPQPPPPAPEPEAQGGEDVGALDCGSPASSTPYFTGLELPGELKLDAPYNF
NHPFSINNLMSEQTPAPPKLDVGFGGYGAEGGEPGVYYQGLYSRSLLNAS
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgctgggctcagtgaagatggaggcccatgacctggccgagtggagctactacccggag
gcgggcgaggtctactcgccggtgaccccagtgcccaccatggcccccctcaactcctac
atgaccctgaatcctctaagctctccctatccccctggggggctccctgcctccccactg
ccctcaggacccctggcacccccagcacctgcagcccccctggggcccactttcccaggc
ctgggtgtcagcggtggcagcagcagctccgggtacggggccccgggtcctgggctggtg
cacgggaaggagatgccgaaggggtatcggcggcccctggcacacgccaagccaccgtat
tcctatatctcactcatcaccatggccatccagcaggcgccgggcaagatgctgaccttg
agtgaaatctaccagtggatcatggacctcttcccttactaccgggagaatcagcagcgc
tggcagaactccattcgccactcgctgtctttcaacgactgcttcgtcaaggtggcgcgt
tccccagacaagcctggcaagggctcctactgggccctacaccccagctcagggaacatg
tttgagaatggctgctacctgcgccgccagaaacgcttcaagctggaggagaaggtgaaa
aaagggggcagcggggctgccaccaccaccaggaacgggacagggtctgctgcctcgacc
accacccccgcggccacagtcacctccccgccccagcccccgcctccagcccctgagcct
gaggcccagggcggggaagatgtgggggctctggactgtggctcacccgcttcctccaca
ccctatttcactggcctggagctcccaggggagctgaagctggacgcgccctacaacttc
aaccaccctttctccatcaacaacctaatgtcagaacagacaccagcacctcccaaactg
gacgtggggtttgggggctacggggctgaaggtggggagcctggagtctactaccagggc
ctctattcccgctctttgcttaatgcatcctag

DBGET integrated database retrieval system