KEGG   Homo sapiens (human): 3172Help
Entry
3172              CDS       T01001                                 

Gene name
HNF4A, FRTS4, HNF4, HNF4a7, HNF4a8, HNF4a9, HNF4alpha, MODY, MODY1, NR2A1, NR2A21, TCF, TCF14
Definition
hepatocyte nuclear factor 4, alpha
Orthology
K07292  
hepatocyte nuclear factor 4-alpha
Organism
hsa  Homo sapiens (human)
Pathway
AMPK signaling pathway
Maturity onset diabetes of the young
Disease
H00410  
Maturity onset diabetes of the young (MODY)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    3172 (HNF4A)
 Human Diseases
  Endocrine and metabolic diseases
   04950 Maturity onset diabetes of the young
    3172 (HNF4A)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    3172 (HNF4A)
Nuclear receptors [BR:hsa03310]
 2. Hepatocyte nuclear factor 4 like
  2A. Hepatocyte nuclear factor 4 receptor
   3172 (HNF4A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20q13.12
AA seq 474 aa AA seqDB search
MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGTNLNAPNSLGVSALC
AICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKC
FRAGMKKEAVQNERDRISTRRSSYEDSSLPSINALLQAEVLSRQITSPVSGINGDIRAKK
IASIADVCESMKEQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMVFK
DVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQIDDNEYAYLKAIIFFDPDAK
GLSDPGKIKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKL
FGMAKIDNLLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEW
PRPRGQAATPETPQPSPPGGSGSEPYKLLPGAVATIVKPLSAIPQPTITKQEVI
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgcgactctccaaaaccctcgtcgacatggacatggccgactacagtgctgcactggac
ccagcctacaccaccctggaatttgagaatgtgcaggtgttgacgatgggcaatgacacg
tccccatcagaaggcaccaacctcaacgcgcccaacagcctgggtgtcagcgccctgtgt
gccatctgcggggaccgggccacgggcaaacactacggtgcctcgagctgtgacggctgc
aagggcttcttccggaggagcgtgcggaagaaccacatgtactcctgcagatttagccgg
cagtgcgtggtggacaaagacaagaggaaccagtgccgctactgcaggctcaagaaatgc
ttccgggctggcatgaagaaggaagccgtccagaatgagcgggaccggatcagcactcga
aggtcaagctatgaggacagcagcctgccctccatcaatgcgctcctgcaggcggaggtc
ctgtcccgacagatcacctcccccgtctccgggatcaacggcgacattcgggcgaagaag
attgccagcatcgcagatgtgtgtgagtccatgaaggagcagctgctggttctcgttgag
tgggccaagtacatcccagctttctgcgagctccccctggacgaccaggtggccctgctc
agagcccatgctggcgagcacctgctgctcggagccaccaagagatccatggtgttcaag
gacgtgctgctcctaggcaatgactacattgtccctcggcactgcccggagctggcggag
atgagccgggtgtccatacgcatccttgacgagctggtgctgcccttccaggagctgcag
atcgatgacaatgagtatgcctacctcaaagccatcatcttctttgacccagatgccaag
gggctgagcgatccagggaagatcaagcggctgcgttcccaggtgcaggtgagcttggag
gactacatcaacgaccgccagtatgactcgcgtggccgctttggagagctgctgctgctg
ctgcccaccttgcagagcatcacctggcagatgatcgagcagatccagttcatcaagctc
ttcggcatggccaagattgacaacctgttgcaggagatgctgctgggagggtcccccagc
gatgcaccccatgcccaccaccccctgcaccctcacctgatgcaggaacatatgggaacc
aacgtcatcgttgccaacacaatgcccactcacctcagcaacggacagatgtgtgagtgg
ccccgacccaggggacaggcagccacccctgagaccccacagccctcaccgccaggtggc
tcagggtctgagccctataagctcctgccgggagccgtcgccacaatcgtcaagcccctc
tctgccatcccccagccgaccatcaccaagcaggaagttatctag

DBGET integrated database retrieval system