KEGG   Homo sapiens (human): 3174Help
Entry
3174              CDS       T01001                                 

Gene name
HNF4G, NR2A2, NR2A3
Definition
(RefSeq) hepatocyte nuclear factor 4 gamma
  KO
K08037  
hepatocyte nuclear factor 4-gamma
Organism
hsa  Homo sapiens (human)
Pathway
Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Endocrine and metabolic diseases
   04950 Maturity onset diabetes of the young
    3174 (HNF4G)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    3174 (HNF4G)
Nuclear receptors [BR:hsa03310]
 2. Hepatocyte nuclear factor 4 like
  2A. Hepatocyte nuclear factor 4 receptor
   3174 (HNF4G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8q21.11
AA seq 445 aa AA seqDB search
MDMANYSEVLDPTYTTLEFETMQILYNSSDSSAPETSMNTTDNGVNCLCAICGDRATGKH
YGASSCDGCKGFFRRSIRKSHVYSCRFSRQCVVDKDKRNQCRYCRLRKCFRAGMKKEAVQ
NERDRISTRRSTFDGSNIPSINTLAQAEVRSRQISVSSPGSSTDINVKKIASIGDVCESM
KQQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMMYKDILLLGNNYVI
HRNSCEVEISRVANRVLDELVRPFQEIQIDDNEYACLKAIVFFDPDAKGLSDPVKIKNMR
FQVQIGLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFVKLFGMVKIDNLLQE
MLLGGASNDGSHLHHPMHPHLSQDPLTGQTILLGPMSTLVHADQISTPETPLPSPPQGSG
QEQYKIAANQASVISHQHLSKQKQL
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggacatggcaaattacagtgaagttttggacccaacttacacaactttggagtttgaa
actatgcagattctatataattcaagtgatagttctgccccagagacaagtatgaatacc
acagacaacggtgtcaactgtctgtgtgctatctgtggggacagagcaacaggaaaacac
tatggggcatccagctgtgatgggtgcaagggtttcttcagacgcagcattcgtaagagt
cacgtttattcttgcaggttcagtcggcaatgtgttgttgacaaggacaaaaggaatcaa
tgtagatattgtcgattaagaaagtgttttagagcgggaatgaaaaaagaagctgtacaa
aatgaacgtgacagaataagcaccagaagaagcacatttgatggcagcaacatcccctcc
attaacacactggcacaagctgaagttcggtctcgccagatctcagtctcaagccctggg
tcaagcactgacataaacgttaagaaaattgcaagtattggtgatgtctgtgaatctatg
aaacagcagctcttagtcttggtggaatgggctaaatatattcctgccttctgtgaatta
ccattggatgatcaggtggcactgttgagagctcacgcaggggagcacttactgcttgga
gctacaaagagatccatgatgtataaagatattttgcttttgggaaacaactatgttatt
caccgcaacagctgtgaagttgagattagccgtgtggccaatcgtgttctagatgagctg
gttagaccatttcaagaaatccagattgatgacaatgagtatgcttgtttaaaggcaatt
gtattttttgatccagatgcaaaagggctaagcgatccagtaaaaattaagaacatgagg
ttccaagtgcagatcggtttggaggactacatcaatgatcggcagtatgactcccggggg
aggtttggagagttgcttctgctcctgcccacactgcagagcatcacgtggcaaatgatt
gagcaaatacagtttgttaaactttttgggatggttaaaattgacaatctacttcaggaa
atgctattaggtggggcttccaatgatggcagtcatctccatcatccaatgcatccacat
ttgtctcaagacccattaactggacaaactatacttttaggtcccatgtcaacactggtt
catgcagaccagatctcaactcctgaaaccccactcccttccccaccacaaggctctggg
caagaacagtacaaaatagctgcaaaccaagcatcagtcatttcacaccagcatctctcc
aaacaaaagcaattgtga

DBGET integrated database retrieval system