KEGG   Homo sapiens (human): 3175Help
Entry
3175              CDS       T01001                                 

Gene name
ONECUT1, HNF-6, HNF6, HNF6A
Definition
one cut homeobox 1
Orthology
K08026  
one cut domain, family member 1, hepatocyte nuclear factor 6
Organism
hsa  Homo sapiens (human)
Pathway
Signaling pathways regulating pluripotency of stem cells
Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cellular commiunity
   04550 Signaling pathways regulating pluripotency of stem cells
    3175 (ONECUT1)
 Human Diseases
  Endocrine and metabolic diseases
   04950 Maturity onset diabetes of the young
    3175 (ONECUT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
15q21.3
AA seq 465 aa AA seqDB search
MNAQLTMEAIGELHGVSHEPVPAPADLLGGSPHARSSVAHRGSHLPPAHPRSMGMASLLD
GGSGGGDYHHHHRAPEHSLAGPLHPTMTMACETPPGMSMPTTYTTLTPLQPLPPISTVSD
KFPHHHHHHHHHHHPHHHQRLAGNVSGSFTLMRDERGLASMNNLYTPYHKDVAGMGQSLS
PLSSSGLGSIHNSQQGLPHYAHPGAAMPTDKMLTPNGFEAHHPAMLGRHGEQHLTPTSAG
MVPINGLPPHHPHAHLNAQGHGQLLGTAREPNPSVTGAQVSNGSNSGQMEEINTKEVAQR
ITTELKRYSIPQAIFAQRVLCRSQGTLSDLLRNPKPWSKLKSGRETFRRMWKWLQEPEFQ
RMSALRLAACKRKEQEHGKDRGNTPKKPRLVFTDVQRRTLHAIFKENKRPSKELQITISQ
QLGLELSTVSNFFMNARRRSLDKWQDEGSSNSGNSSSSSSTCTKA
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgcagctgaccatggaagcgatcggcgagctgcacggggtgagccatgagccg
gtgcccgcccctgccgacctgctgggcggcagcccccacgcgcgcagctccgtggcgcac
cgcggcagccacctgccccccgcgcacccgcgctccatgggcatggcgtccctgctggac
ggcggcagcggcggcggagattaccaccaccaccaccgggcccctgagcacagcctggcc
ggccccctgcatcccaccatgaccatggcctgcgagactcccccaggtatgagcatgccc
accacctacaccaccttgacccctctgcagccgctgcctcccatctccacagtctcggac
aagttcccccaccatcaccaccaccaccatcaccaccaccacccgcaccaccaccagcgc
ctggcgggcaacgtgagcggtagcttcacgctcatgcgggatgagcgcgggctggcctcc
atgaataacctctataccccctaccacaaggacgtggccggcatgggccagagcctctcg
cccctctccagctccggtctgggcagcatccacaactcccagcaagggctcccccactat
gcccacccgggggccgccatgcccaccgacaagatgctcacccccaacggcttcgaagcc
caccacccggccatgctcggccgccacggggagcagcacctcacgcccacctcggccggc
atggtgcccatcaacggccttcctccgcaccatccccacgcccacctgaacgcccagggc
cacgggcaactcctgggcacagcccgggagcccaacccttcggtgaccggcgcgcaggtc
agcaatggaagtaattcagggcagatggaagagatcaataccaaagaggtggcgcagcgt
atcaccaccgagctcaagcgctacagcatcccacaggccatcttcgcgcagagggtgctc
tgccgctcccaggggaccctctcggacctgctgcgcaaccccaaaccctggagcaaactc
aaatccggccgggagaccttccggaggatgtggaagtggctgcaggagccggagttccag
cgcatgtccgcgctccgcttagcagcatgcaaaaggaaagaacaagaacatgggaaggat
agaggcaacacacccaaaaagcccaggttggtcttcacagatgtccagcgtcgaactcta
catgcaatattcaaggaaaataagcgtccatccaaagaattgcaaatcaccatttcccag
cagctggggttggagctgagcactgtcagcaacttcttcatgaacgcaagaaggaggagt
ctggacaagtggcaggacgagggcagctccaattcaggcaactcatcttcttcatcaagc
acttgtaccaaagcatga

DBGET integrated database retrieval system