KEGG   Homo sapiens (human): 3175Help
Entry
3175              CDS       T01001                                 

Gene name
ONECUT1, HNF-6, HNF6, HNF6A
Definition
one cut homeobox 1
Orthology
K08026  
one cut domain, family member 1, hepatocyte nuclear factor 6
Organism
hsa  Homo sapiens (human)
Pathway
Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Endocrine and metabolic diseases
   04950 Maturity onset diabetes of the young
    3175 (ONECUT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
15q21.3
AA seq 465 aa AA seqDB search
MNAQLTMEAIGELHGVSHEPVPAPADLLGGSPHARSSVAHRGSHLPPAHPRSMGMASLLD
GGSGGGDYHHHHRAPEHSLAGPLHPTMTMACETPPGMSMPTTYTTLTPLQPLPPISTVSD
KFPHHHHHHHHHHHPHHHQRLAGNVSGSFTLMRDERGLASMNNLYTPYHKDVAGMGQSLS
PLSSSGLGSIHNSQQGLPHYAHPGAAMPTDKMLTPNGFEAHHPAMLGRHGEQHLTPTSAG
MVPINGLPPHHPHAHLNAQGHGQLLGTAREPNPSVTGAQVSNGSNSGQMEEINTKEVAQR
ITTELKRYSIPQAIFAQRVLCRSQGTLSDLLRNPKPWSKLKSGRETFRRMWKWLQEPEFQ
RMSALRLAACKRKEQEHGKDRGNTPKKPRLVFTDVQRRTLHAIFKENKRPSKELQITISQ
QLGLELSTVSNFFMNARRRSLDKWQDEGSSNSGNSSSSSSTCTKA
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgcagctgaccatggaagcgatcggcgagctgcacggggtgagccatgagccg
gtgcccgcccctgccgacctgctgggcggcagcccccacgcgcgcagctccgtggcgcac
cgcggcagccacctgccccccgcgcacccgcgctccatgggcatggcgtccctgctggac
ggcggcagcggcggcggagattaccaccaccaccaccgggcccctgagcacagcctggcc
ggccccctgcatcccaccatgaccatggcctgcgagactcccccaggtatgagcatgccc
accacctacaccaccttgacccctctgcagccgctgcctcccatctccacagtctcggac
aagttcccccaccatcaccaccaccaccatcaccaccaccacccgcaccaccaccagcgc
ctggcgggcaacgtgagcggtagcttcacgctcatgcgggatgagcgcgggctggcctcc
atgaataacctctataccccctaccacaaggacgtggccggcatgggccagagcctctcg
cccctctccagctccggtctgggcagcatccacaactcccagcaagggctcccccactat
gcccacccgggggccgccatgcccaccgacaagatgctcacccccaacggcttcgaagcc
caccacccggccatgctcggccgccacggggagcagcacctcacgcccacctcggccggc
atggtgcccatcaacggccttcctccgcaccatccccacgcccacctgaacgcccagggc
cacgggcaactcctgggcacagcccgggagcccaacccttcggtgaccggcgcgcaggtc
agcaatggaagtaattcagggcagatggaagagatcaataccaaagaggtggcgcagcgt
atcaccaccgagctcaagcgctacagcatcccacaggccatcttcgcgcagagggtgctc
tgccgctcccaggggaccctctcggacctgctgcgcaaccccaaaccctggagcaaactc
aaatccggccgggagaccttccggaggatgtggaagtggctgcaggagccggagttccag
cgcatgtccgcgctccgcttagcagcatgcaaaaggaaagaacaagaacatgggaaggat
agaggcaacacacccaaaaagcccaggttggtcttcacagatgtccagcgtcgaactcta
catgcaatattcaaggaaaataagcgtccatccaaagaattgcaaatcaccatttcccag
cagctggggttggagctgagcactgtcagcaacttcttcatgaacgcaagaaggaggagt
ctggacaagtggcaggacgagggcagctccaattcaggcaactcatcttcttcatcaagc
acttgtaccaaagcatga

DBGET integrated database retrieval system