KEGG   Homo sapiens (human): 3176Help
Entry
3176              CDS       T01001                                 

Gene name
HNMT, HMT, HNMT-S1, HNMT-S2
Definition
histamine N-methyltransferase (EC:2.1.1.8)
Orthology
K00546  
histamine N-methyltransferase [EC:2.1.1.8]
Organism
hsa  Homo sapiens (human)
Pathway
Histidine metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    3176 (HNMT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.8  histamine N-methyltransferase
     3176 (HNMT)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   3176 (HNMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q22.1
AA seq 51 aa AA seqDB search
MASSMRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRYQNCC
NT seq 156 nt NT seq  +upstreamnt  +downstreamnt
atggcatcttccatgaggagcttgttttctgaccacgggaaatatgttgaatctttccgg
aggtttctcaaccattccacggaacaccagtgcatgcaggaattcatggacaagaagctg
ccaggcataataggaagataccagaattgctgttaa

DBGET integrated database retrieval system