KEGG   Homo sapiens (human): 317749Help
Entry
317749            CDS       T01001                                 

Gene name
DHRS4L2, SDR25C3
Definition
dehydrogenase/reductase (SDR family) member 4 like 2
Orthology
K11148  
dehydrogenase/reductase SDR family member 4-like protein 2 [EC:1.1.-.-]
Organism
hsa  Homo sapiens (human)
Pathway
Retinol metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:hsa00830]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q11.2
AA seq 170 aa AA seqDB search
MPFPCLSLPSSWDYRIGFAIARRLAQDRAHVVVSSRKQQNVDQAVATLQGEGLSVTGTVC
HVGKAEDRERLVAMTLDINVKAPALMTKAVVPEMEKRGGGSVVIVSSIAAFSPSPGFSPY
NVSKTALLGLNNTLAIELAPRNIRVNCLHLDLSRLASAGCSGWTRKKRKA
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgccattcccctgcctcagcctcccgagtagctgggactacaggatcggcttcgccatc
gcccggcgtttggcccaggacagggcccacgtggtcgtcagcagccggaagcagcagaat
gtggaccaggcggtggccacgctgcagggggaggggctgagcgtgacgggcactgtgtgc
catgtggggaaggcggaggaccgggagcggctggtggccatgactctggacattaatgtg
aaggccccagccctgatgacaaaggcagtggtgccagaaatggagaaacgaggaggcggc
tcagtggtgatcgtgtcttccatagcagccttcagtccatctcctggcttcagtccttac
aatgtcagtaaaacagccttgctgggcctcaacaataccctggccatagagctggcccca
aggaacattagggtgaactgcctgcacctggacttatcaagactagcttcagcaggatgc
tctggatggacaaggaaaaagaggaaagcatga

DBGET integrated database retrieval system