KEGG   Homo sapiens (human): 317749Help
Entry
317749            CDS       T01001                                 

Gene name
DHRS4L2, SDR25C3
Definition
(RefSeq) dehydrogenase/reductase 4 like 2
  KO
K11148  dehydrogenase/reductase SDR family member 4-like protein 2 [EC:1.1.-.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00830  Retinol metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    317749 (DHRS4L2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.-  Acting on the CH-OH group of donors
    1.1.-.-  
     317749 (DHRS4L2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR
Motif
Other DBs
NCBI-GeneID: 317749
NCBI-ProteinID: NP_001180564
OMIM: 615196
HGNC: 19731
Ensembl: ENSG00000187630
Vega: OTTHUMG00000028778
UniProt: D5KJA1
Position
14q11.2
AA seq 170 aa AA seqDB search
MPFPCLSLPSSWDYRIGFAIARRLAQDRAHVVVSSRKQQNVDQAVATLQGEGLSVTGTVC
HVGKAEDRERLVAMTLDINVKAPALMTKAVVPEMEKRGGGSVVIVSSIAAFSPSPGFSPY
NVSKTALLGLNNTLAIELAPRNIRVNCLHLDLSRLASAGCSGWTRKKRKA
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgccattcccctgcctcagcctcccgagtagctgggactacaggatcggcttcgccatc
gcccggcgtttggcccaggacagggcccacgtggtcgtcagcagccggaagcagcagaat
gtggaccaggcggtggccacgctgcagggggaggggctgagcgtgacgggcactgtgtgc
catgtggggaaggcggaggaccgggagcggctggtggccatgactctggacattaatgtg
aaggccccagccctgatgacaaaggcagtggtgccagaaatggagaaacgaggaggcggc
tcagtggtgatcgtgtcttccatagcagccttcagtccatctcctggcttcagtccttac
aatgtcagtaaaacagccttgctgggcctcaacaataccctggccatagagctggcccca
aggaacattagggtgaactgcctgcacctggacttatcaagactagcttcagcaggatgc
tctggatggacaaggaaaaagaggaaagcatga

DBGET integrated database retrieval system